Muscle Phosphofructokinase/PFKM/PFK-1 Recombinant Protein Antigen Summary
| Description |
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human PFKM. Source: E. coli
Amino Acid Sequence: CVQVTKDVTKAMDEKKFDEALKLRGRSFMNNWEVYKLLAHVRPPVSKSGSHTVAVMNVGAPAAGMNAAVRSTVRIGLIQGNRVLVVHDGFEGLAKGQIEEAGWSYVGGWTGQGGSKLGTKRTLPKKSFEQISA Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)
This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions. |
| Source |
E. coli |
| Protein/Peptide Type |
Recombinant Protein Antigen |
| Gene |
PFKM |
| Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Applications/Dilutions
| Dilutions |
- Antibody Competition 10 - 100 molar excess
|
| Application Notes |
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-87293. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml. For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com |
| Theoretical MW |
32 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles. |
| Buffer |
PBS and 1M Urea, pH 7.4. |
| Preservative |
No Preservative |
| Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Alternate Names for Muscle Phosphofructokinase/PFKM/PFK-1 Recombinant Protein Antigen
Background
Phosphofructokinases (PFK) are regulatory glycolytic enzymes that convert fructose 6-phosphate and ATP into fructose 1,6-bisphosphate (through PFK-1), fructose 2,6-bisphosphate (through PFK-2) and ADP. Human PFK-1 is tetrameric and isoenzymes include PFK-1 muscle (PFKM, PFK-A), PFK-1 liver (PFKL, PFK-B) and PFK-1 platelet (PFKP, PFK-C, PFKF). PFK-1 is inhibited by ATP and citrate (from the tricarboxylic acid cycle). PFK-1 undergoes activation in the presence of elevated AMP. The most potent activator is fructose 2,6-bisphosphate, which is produced by PFK-2 from the same substrate, fructose 6-phosphate. PFK-2 is bifunctional and a key regulator for PFK-1. PFK-2 catalyzes the synthesis of fructose 2,6-bisphosphate and contains fructose 2,6-biphosphatase activity that catalyzes the degradation of fructose 2,6-bisphosphate. PFK-2 is dimeric and isoenzymes include PFK-2 liver (PFKFB1, PFRX), PFK-2 cardiac (PFKFB2), PFK-2 placental (PFKFB3, inducible PFK-2) and PFK-2 testis (PFKFB4).
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu, Rt
Applications: ELISA, IP, WB
Species: Bv, Hu, Mu
Applications: ICC, IHC
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, IP, WB
Species: Hu, Pm, Mu, Pm, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: CyTOF-ready, Flow, Simple Western, WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, WB
Species: Hu, Mu
Applications: CyTOF-ready, ICC, ICFlow
Species: Hu, Mu, Rb, Rt
Applications: ChIP, ChIP, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, In vitro, Simple Western, WB
Species: Hu
Applications: IHC, WB
Species: Mu, Rt, Ze
Applications: IHC-WhMt, IHC, WB
Species: Mu, Rt
Applications: ICC/IF, WB
Species: Ba, Bv, Ch, Hu, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu
Applications: IB, IHC, IHC-Fr, WB
Species: Bv, Hu, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Ca, Hu, Mu, Rt
Applications: Flow, ICC/IF, WB
Species: Bv, Ca, Hu
Applications: IHC, IHC-P, PEP-ELISA, WB
Publications for Muscle Phosphofructokinase/PFKM/PFK-1 Protein (NBP1-87293PEP) (0)
There are no publications for Muscle Phosphofructokinase/PFKM/PFK-1 Protein (NBP1-87293PEP).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for Muscle Phosphofructokinase/PFKM/PFK-1 Protein (NBP1-87293PEP) (0)
There are no reviews for Muscle Phosphofructokinase/PFKM/PFK-1 Protein (NBP1-87293PEP).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
FAQs for Muscle Phosphofructokinase/PFKM/PFK-1 Protein (NBP1-87293PEP) (0)
Additional Muscle Phosphofructokinase/PFKM/PFK-1 Products
Research Areas for Muscle Phosphofructokinase/PFKM/PFK-1 Protein (NBP1-87293PEP)
Find related products by research area.
|
Blogs on Muscle Phosphofructokinase/PFKM/PFK-1