MUL1 Antibody


Western Blot: MUL1 Antibody [NBP1-59068] - Human Heart lysate, concentration 0.2-1 ug/ml.
Western Blot: MUL1 Antibody [NBP1-59068] - Sample Tissue: Human Fetal Heart.

Product Details

Reactivity HuSpecies Glossary
Applications WB

Order Details

MUL1 Antibody Summary

Synthetic peptides corresponding to C1ORF166 The peptide sequence was selected from the middle region of C1ORF166 (NP_078820). Peptide sequence GMQYYLSSQDFDSLLQRQESSVRLWKVLALVFGFATCATLFFILRKQYLQ.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.2-1 ug/ml
Theoretical MW
40 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Read Publications using
NBP1-59068 in the following applications:

  • WB
    2 publications

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS & 2% Sucrose.
No Preservative
Immunogen affinity purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for MUL1 Antibody

  • C1orf166mitochondrial E3 ubiquitin ligase 1
  • E3 ubiquitin-protein ligase MUL1
  • EC 6.3.2
  • EC 6.3.2.-
  • FLJ12875
  • GIDERP11-401M16.2
  • Growth inhibition and death E3 ligase
  • MAPLE3 ubiquitin ligase
  • mitochondrial E3 ubiquitin protein ligase 1
  • mitochondrial ubiquitin ligase activator of NFKB 1
  • mitochondrial ubiquitin ligase activator of NF-kB
  • Mitochondrial-anchored protein ligase
  • MULANchromosome 1 open reading frame 166
  • Putative NF-kappa-B-activating protein 266
  • RING finger protein 218
  • RNF218mitochondria-anchored protein ligase


The function of C1orf166 remains unknown.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
Species: Hu, Rt
Applications: WB, IHC, IHC-Fr, IHC-P, IP
Species: Hu
Applications: WB, IP
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Mu
Applications: WB, IP
Species: Hu, Mu
Applications: WB (-), ICC/IF, IHC, IHC-P, IP
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, ICC
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC
Species: Hu
Applications: WB, PEP-ELISA
Species: Hu
Applications: WB, Simple Western, ICC
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, CyTOF-ready, ICFlow
Species: Hu, Mu
Applications: WB, IHC, IHC-Fr, IHC-P, IP
Species: Hu
Applications: WB

Publications for MUL1 Antibody (NBP1-59068)(2)

We have publications tested in 2 confirmed species: Human, Mouse.

We have publications tested in 1 application: WB.

Filter By Application
All Applications
Filter By Species
All Species

Reviews for MUL1 Antibody (NBP1-59068) (0)

There are no reviews for MUL1 Antibody (NBP1-59068). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for MUL1 Antibody (NBP1-59068) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional MUL1 Products

Bioinformatics Tool for MUL1 Antibody (NBP1-59068)

Discover related pathways, diseases and genes to MUL1 Antibody (NBP1-59068). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MUL1 Antibody (NBP1-59068)

Discover more about diseases related to MUL1 Antibody (NBP1-59068).

Pathways for MUL1 Antibody (NBP1-59068)

View related products by pathway.

PTMs for MUL1 Antibody (NBP1-59068)

Learn more about PTMs related to MUL1 Antibody (NBP1-59068).

Research Areas for MUL1 Antibody (NBP1-59068)

Find related products by research area.

Blogs on MUL1.

MUL1 - A Mito's best friend
MUL1 is an E3 ubiquitin-protein ligase with a RING finger domain that controls mitochondrial morphology, fragmentation and localization. E3 ubiquitin ligases accept the component ubiquitin from a donor E2 ubiquitin-conjugating directly transfer this u...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our MUL1 Antibody and receive a gift card or discount.


Gene Symbol MUL1