Mucolipin 1 Antibody - BSA Free

Western Blot: Mucolipin 1 Antibody [NBP1-92152] - Analysis in human cell line PC-3.

Immunocytochemistry/Immunofluorescence: Mucolipin 1 Antibody [NBP1-92152] - Staining of human cell line U-2 OS shows localization to plasma membrane & cytosol. Antibody staining is shown in green.

Analysis in human cell line PC-3.

• Reactivity: Hu
• Applications: WB, Flow, ICC/IF, Mycoplasma
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

Mucolipin 1 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit Mucolipin 1 Antibody - BSA Free (NBP1-92152) is a polyclonal antibody validated for use in WB, Flow and ICC/IF. Anti-Mucolipin 1 Antibody: Cited in 3 publications. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: DTIKHPGGAGAEESELQAYIAQCQDSPTSGKFRRGSGSACSLLCCCGRDPSE
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: MCOLN1
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Flow Cytometry Reported in scientific literature (PMID:31950548).
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Knockdown Validated Reported in scientific literature ((PMID: 31950548)
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  Mucolipin 1 Protein (NBP1-92152PEP)

Reactivity Notes

Mouse 87%, Rat 85%

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for Mucolipin 1 Antibody - BSA Free

• MCOLN1
• MG-2
• ML1
• ML4
• ML4TRP-ML1
• MLIV
• MST080
• MSTP080
• Mucolipidin
• mucolipidosis type IV protein
• Mucolipin 1
• mucolipin-1
• TRPML1
• TRP-ML1
• TRPM-L1

Background

Mucolipin-1 (MCOLN1) is a 65kDa member of the TRPML channel family, which is a subgroup of the large protein family of TRP ion channels. Mucolipin 1 is thought to channel iron ions across the endosome/lysosome membrane into the cell, so defective MCOLN1 may cause cellular iron deficiency.

Defects in MCOLN1 are known to cause mucolipidosis type IV (MLIV), also known as sialolipidosis. MLIV is an autosomal recessive lysosomal storage disorder characterized by severe psychomotor retardation and ophthalmologic abnormalities, including corneal opacity, retinal degeneration and strabismus. Storage bodies of lipids and water-soluble substances are seen by electron microscopy in almost every cell type of the patients. Most patients are unable to speak or walk independently and reach a maximal developmental level of 1-2 years. All patients have constitutive achlorhydia associated with a secondary elevation of serum gastrin levels.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for Mucolipin 1 Antibody (NBP1-92152)(3)

Publications using NBP1-92152

• Shi J, Li X, Ding J et al. Transient Receptor Potential Mucolipin-1 Participates in Intracerebral Hemorrhage-Induced Secondary Brain Injury by Inducing Neuroinflammation and Neuronal Cell Death Neuromolecular medicine 2023-02-04 [PMID: 36737508]
• Khan N, Halcrow PW, Lakpa KL et al. Two-pore channels regulate Tat endolysosome escape and Tat-mediated HIV-1 LTR transactivation FASEB J. 2020-01-16 [PMID: 31950548] (KD, FLOW)
• Fernandez-Mosquera, L;Yambire, KF;Couto, R;Pereyra, L;Pabis, K;Ponsford, AH;Diogo, CV;Stagi, M;Milosevic, I;Raimundo, N; Mitochondrial respiratory chain deficiency inhibits lysosomal hydrolysis Autophagy 2019-03-27 [PMID: 30917721] (WB, Human)

Bioinformatics

• Gene Symbol: MCOLN1