MUCDHL Antibody

Images

 
Western Blot: MUCDHL Antibody [NBP1-92148] - Staining of human small intestine shows high expression.
Immunohistochemistry-Paraffin: MUCDHL Antibody [NBP1-92148] - Staining in human small intestine and cervix, uterine tissues using anti-CDHR5 antibody. Corresponding CDHR5 RNA-seq data are presented for the same tissues.
Immunohistochemistry: MUCDHL Antibody [NBP1-92148] - Staining of human kidney shows strong cytoplasmic and luminal membrane positivity in cells in tubules.
Immunohistochemistry-Paraffin: MUCDHL Antibody [NBP1-92148] - Staining of human cervix, uterine shows low expression as expected.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

MUCDHL Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: CIQAQYHGAVPTGHILPSPLVLRPGPIYAEDGDRGINQPIIYSIFRGNVNGTFIIHPDSGNLTVARSVPSPMTFLLLVKGQQADLARYSVTQVTVEAVAAAGSPPRFPQSLYRGTVARGAGAGVVVKDA
Specificity
Specificity of human MUCDHL antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CDHR5
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
MUCDHL Protein (NBP1-92148PEP)
Publications
Read Publication using NBP1-92148.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for MUCDHL Antibody

  • cadherin-related family member 5
  • CDHR5
  • FLJ20219
  • MUCDHL
  • MUCDHLmucin-like protocadherin
  • Mucin and cadherin-like protein
  • mucin and cadherin-like
  • MUPCDH
  • MU-PCDH
  • mu-protocadherin

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-45745
Species: Hu
Applications: WB, IHC, IF
NB100-56410
Species: Hu
Applications: WB
NB100-86989
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP
NBP1-92534
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-54467
Species: Hu, Mu, Rt, Ch, Pm
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
NBP2-30918
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-32531
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-54467
Species: Hu, Mu, Rt, Ch, Pm
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
NBP2-44374
Species: Hu
Applications: Flow, IHC-P, IF
NB120-11197
Species: Hu, Mu
Applications: WB, Flow, IHC, IHC-Fr, IHC-P, Flow-IC
NB100-2136
Species: Hu
Applications: IHC, IHC-P, IP
NBP1-81410
Species: Hu
Applications: IHC, IHC-P
AF7669
Species: Hu, Mu, Rt
Applications: WB
NBP1-81162
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-77847
Species: Hu, Mu, Rt
Applications: WB, ChIP, ELISA, IHC, IHC-P, IP
NBP2-14424
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-77005
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-24727
Species: Hu, Mu, Ca
Applications: WB, ICC/IF

Publications for MUCDHL Antibody (NBP1-92148)(1)

Reviews for MUCDHL Antibody (NBP1-92148) (0)

There are no reviews for MUCDHL Antibody (NBP1-92148). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for MUCDHL Antibody (NBP1-92148) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for MUCDHL Antibody (NBP1-92148)

Discover related pathways, diseases and genes to MUCDHL Antibody (NBP1-92148). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MUCDHL Antibody (NBP1-92148)

Discover more about diseases related to MUCDHL Antibody (NBP1-92148).
 

Pathways for MUCDHL Antibody (NBP1-92148)

View related products by pathway.

PTMs for MUCDHL Antibody (NBP1-92148)

Learn more about PTMs related to MUCDHL Antibody (NBP1-92148).

Blogs on MUCDHL

There are no specific blogs for MUCDHL, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our MUCDHL Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CDHR5
Entrez