DUSP8 Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: DUSP8 Antibody [NBP1-88385] - Immunofluorescent staining of human cell line U-251 MG shows localization to cytosol.

Staining of human skeletal muscle shows moderate cytoplasmic positivity in myocytes.

Staining of human colon shows strong cytoplasmic positivity in endothelial cells.

Staining of human kidney shows strong cytoplasmic positivity in cells in glomeruli.

Staining of human cerebral cortex shows strong cytoplasmic positivity in endothelial cells and glial cells.

• Reactivity: Hu
• Applications: ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

DUSP8 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: SDDAYRFVKDRRPSISPNFNFLGQLLEYERSLKLLAALQGDPGTPSGTPEPPPSPAAGAPLPRLPPPTSESAATGNAAAR
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: DUSP8
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICCIF Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  DUSP8 Protein (NBP1-88385PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (84%), Rat (84%)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for DUSP8 Antibody - BSA Free

• C11orf81
• chromosome 11 open reading frame 81
• dual specificity phosphatase 8
• Dual specificity protein phosphatase hVH-5
• EC 3.1.3.16
• EC 3.1.3.48
• FLJ42476
• FLJ42958
• HVH8
• serine/threonine specific protein phosphatase
• vaccinia virus homolog
• VH5

Background

DUSP8 is a member of the dual specificity protein phosphatase subfamily. These phosphatases inactivate their target kinases by dephosphorylating both the phosphoserine/threonine and phosphotyrosine residues. They negatively regulate members of the mitogen-activated protein (MAP) kinase superfamily (MAPK/ERK, SAPK/JNK, p38), which is associated with cellular proliferation and differentiation. Different members of the family of dual specificity phosphatases show distinct substrate specificities for various MAP kinases, different tissue distribution and subcellular localization, and different modes of inducibility of their expression by extracellular stimuli. DUSP8 inactivates SAPK/JNK and p38, is expressed predominantly in the adult brain, heart, and skeletal muscle, is localized in the cytoplasm, and is induced by nerve growth factor and insulin. An intronless pseudogene for DUSP8 is present on chromosome 10q11.2.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for DUSP8 Antibody (NBP1-88385)(1)

Publication using NBP1-88385

• Kati Turkowski, Frederik Herzberg, Stefan Günther, Andreas Weigert, Tamara Haselbauer, Ludger Fink, David Brunn, Friedrich Grimminger, Werner Seeger, Holger Sültmann, Thorsten Stiewe, Soni S. Pullamsetti, Rajkumar Savai miR-147b mediated suppression of DUSP8 promotes lung cancer progression Oncogene 2024-02-23 [PMID: 38396293]

Bioinformatics

• Gene Symbol: DUSP8