Recombinant Human MUC7 GST (N-Term) Protein

Images

 
SDS-Page: Recombinant Human MUC7 Protein [H00004589-Q01] - 12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, PAGE, AP

Order Details

Recombinant Human MUC7 GST (N-Term) Protein Summary

Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 36-135 of Human MUC7

Source: Wheat Germ (in vitro)

Amino Acid Sequence: HQSPKSHFELPHYPGLLAHQKPFIRKSYKCLHKRCRPKLPPSPNNPPKFPNPHQPPKHPDKNSSVVNPTLVATTQIPSVTFPSASTKITTLPNVTFLPQN

Preparation
Method
in vitro wheat germ expression system
Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Partial Recombinant Protein
Gene
MUC7
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Theoretical MW
36.74 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Publications
Read Publication using H00004589-Q01.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human MUC7 GST (N-Term) Protein

  • apo-MG2
  • DKFZp686J03256
  • FLJ27047
  • MG2MGC34772
  • MUC-7
  • mucin 7, secreted
  • mucin-7
  • Salivary mucin-7
  • salivary

Background

MUC7 - mucin 7, salivary

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-92151
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-52193
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NB120-11197
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, Flow-IC
NBP2-15196
Species: Hu, Mu, Rt, Po, Ch, Fe, Pm, Rb, Bv(-)
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, Flow-IC
NB120-22711
Species: Hu, Mu
Applications: ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-44374
Species: Hu
Applications: Flow, IHC, IHC-P, IF
NBP2-47687
Species: Hu, Rt(-)
Applications: Flow, IHC, IHC-P, CyTOF-ready, IF
NB120-10109
Species: Hu
Applications: WB, Flow, IHC, IHC-P, S-ELISA, CyTOF-ready
H00003347-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, S-ELISA
NBP2-61118
Species: Hu, Mu
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P
MAB59151
Species: Mu
Applications: WB
MAB25031
Species: Hu
Applications: WB, IHC, IP
NB200-125
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP1-85599
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NB600-1468
Species: Hu
Applications: WB, S-ELISA
NBP2-70481
Species: Hu
Applications: WB, Flow, ICC/IF, CyTOF-ready
NBP1-92450
Species: Hu
Applications: IHC, IHC-P
H00004589-Q01
Species: Hu
Applications: WB, ELISA, PA, PAGE, AP

Publications for MUC7 Partial Recombinant Protein (H00004589-Q01)(1)

Reviews for MUC7 Partial Recombinant Protein (H00004589-Q01) (0)

There are no reviews for MUC7 Partial Recombinant Protein (H00004589-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for MUC7 Partial Recombinant Protein (H00004589-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Other Available Formats

Additional MUC7 Products

Bioinformatics Tool for MUC7 Partial Recombinant Protein (H00004589-Q01)

Discover related pathways, diseases and genes to MUC7 Partial Recombinant Protein (H00004589-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MUC7 Partial Recombinant Protein (H00004589-Q01)

Discover more about diseases related to MUC7 Partial Recombinant Protein (H00004589-Q01).
 

Pathways for MUC7 Partial Recombinant Protein (H00004589-Q01)

View related products by pathway.

PTMs for MUC7 Partial Recombinant Protein (H00004589-Q01)

Learn more about PTMs related to MUC7 Partial Recombinant Protein (H00004589-Q01).

Blogs on MUC7

There are no specific blogs for MUC7, but you can read our latest blog posts.

Customers Who Bought This Also Bought

MUC5AC Antibody (45M1)
NBP2-15196-0.1mg

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human MUC7 GST (N-Term) Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol MUC7