Home » MUC7 » MUC7 Proteins » Recombinant Human MUC7 GST (N-Term) Protein

Recombinant Human MUC7 GST (N-Term) Protein

 (1 Publication)
 See All Related
Submit a Review

Images

 
(
Enlarge)
SDS-Page: Recombinant Human MUC7 Protein [H00004589-Q01] - 12.5% SDS-PAGE Stained with Coomassie Blue.
SDS-Page: Recombinant Human MUC7 Protein [H00004589-Q01] - 12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, PAGE, AP

Order Details

100% Guarantee on every product

Recombinant Human MUC7 GST (N-Term) Protein Summary

Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 36-135 of Human MUC7

Source: Wheat Germ (in vitro)

Amino Acid Sequence: HQSPKSHFELPHYPGLLAHQKPFIRKSYKCLHKRCRPKLPPSPNNPPKFPNPHQPPKHPDKNSSVVNPTLVATTQIPSVTFPSASTKITTLPNVTFLPQN
Preparation
Method
in vitro wheat germ expression system
Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Partial Recombinant Protein
Gene
MUC7
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Theoretical MW
36.74 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Publications
Read Publication using H00004589-Q01.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human MUC7 GST (N-Term) Protein

  • apo-MG2
  • DKFZp686J03256
  • FLJ27047
  • MG2MGC34772
  • MUC-7
  • mucin 7, secreted
  • mucin-7
  • Salivary mucin-7
  • salivary

Background

MUC7 - mucin 7, salivary

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

MUC5B Antibody
NBP1-92151
Immunocytochemistry/Immunofluorescence: MUC5B Antibody [NBP1-92151] - Staining of human cell line A549 shows localization to vesicles. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: MUC5B Antibody [NBP1-92151] - Staining of human skeletal muscle shows no positivity in myocytes as expected.
Immunohistochemistry-Paraffin: MUC5B Antibody [NBP1-92151] - Analysis in human cervix, uterine and skeletal muscle tissues. Corresponding MUC5B RNA-seq data are presented for the same tissues.
(3 Publications)
Species: Hu
Applications: ICC/IF, IHC, IHC-P
MUC4 Antibody
NBP1-52193
Western Blot: MUC4 Antibody [NBP1-52193] - MUC4 is shown in the green channel, with beta-tubulin in red channel and Precision Plus dual color protein ladder in the left. The main band is about 60 kDa, with another band about 40 kDa. Image from verified customer review.
Immunocytochemistry/Immunofluorescence: MUC4 Antibody [NBP1-52193] - Staining of MUC4 in HepG2 cells with FITC (green). Nuclei were counterstained with DAPI (blue).
Immunohistochemistry: MUC4 Antibody [NBP1-52193] - Staining of MUC4 in mouse prostate
(1 Review)
(2 Publications)
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
MUC2 Antibody
(996/1)
NB120-11197
Immunocytochemistry/Immunofluorescence: MUC2 Antibody (996/1) [NB120-11197] - MS-induced intestinal epithelium injury was CRHR1 dependent.Photomicrographs of immunofluorescence of Mucin 2 (Muc2; mucous-forming protein) (F-J) in proximal colon in all experimental groups. Image collected and cropped by CiteAb from the following publication (nature.com/articles/srep46616), licensed under a CC-BY licence.
Flow Cytometry: MUC2 Antibody (996/1) [NB120-11197] - An intracellular stain was performed on HeLa cells with MUC2 Antibody [996/1] NB120-11197AF647 (blue) and a matched isotype control (orange). Cells were fixed with 4% PFA and then permeabilized with 0.1% saponin. Cells were incubated in an antibody dilution of 2.5 ug/mL for 30 minutes at room temperature. Both antibodies were conjugated to Alexa Fluor 647.
Immunocytochemistry/Immunofluorescence: MUC2 Antibody (996/1) [NB120-11197] - MS-induced intestinal epithelium injury was CRHR1 dependent. Photomicrographs of immunofluorescence of Mucin 2 (Muc2; mucous-forming protein) (F-J) in proximal colon in all experimental groups. Image collected and cropped by CiteAb from the following publication (nature.com/articles/srep46616), licensed under a CC-BY licence.
(1 Review)
(3 Publications)
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, Flow-IC
MUC5AC Antibody
(45M1)
NBP2-15196
Western Blot: MUC5AC Antibody (45M1) [NBP2-15196] - AGS human gastric adenocarcinoma and KATO-III human gastric carcinoma cell line lysates. Image from verified customer review.
Immunohistochemistry-Paraffin: MUC5AC Antibody (45M1) [NBP2-15196] - Formalin-fixed, paraffin-embedded human Gastric Carcinoma stained with MUC5AC Monoclonal Antibody (45M1).
Flow Cytometry: MUC5AC Antibody (45M1) [NBP2-15196] - An intracellular stain was performed on A549 cells with Mucin 5AC (45M1) antibody NBP2-15196PE (blue) and a matched isotype control NBP2-27287PE (orange). To block the secretion of Mucin 5AC, cells were treated with 3uM Monensin for 3 hours. Cells were fixed with 4% PFA and then permeablized with 0.1% saponin. Cells were incubated in an antibody dilution of 1 ug/mL for 30 minutes at room temperature. Both Antibodies were conjugated to Phycoerythrin.
(4 Reviews)
(9 Publications)
Species: Hu, Mu, Rt, Po, Ch, Fe, Pm, Rb, Bv(-)
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, Flow-IC
MUC1 Antibody (SM3)
NB120-22711
Immunocytochemistry/Immunofluorescence: MUC-1 Antibody (SM3) [NB120-22711] - MCF7 cells were fixed for 10 minutes using 10% formalin and then permeabilized for 5 minutes using 1X PBS + 0.05% Triton-X100. The cells were incubated with anti-MUC1 [SM3] at 5 ug/ml overnight at 4C and detected with an anti-mouse IgG Dylight 488 (Green) at a 1:500 dilution. Nuclei were counterstained with DAPI (Blue). Cells were imaged using a 40X objective.
Immunohistochemistry-Paraffin: MUC-1 Antibody (SM3) [NB120-22711] - IHC analysis of formalin fixed paraffin embedded tissue section of human breast cancer xenograft using MUC-1 antibody clone SM3 at 1:10 dilution. The xenograft section depicted a very specific and intense signal in the periphery of the cancer cells. The necrotic cells also developed a strong immune-positivity while the tumor stroma as well as the nuclei of cells were negative for immunostaining.
Immunocytochemistry/Immunofluorescence: MUC-1 Antibody (SM3) [NB120-22711] - MUC-1 antibody was tested in MCF7 cells at 10 ug/ml using a Dylight 488 conjugated secondary antibody (Green). Actin (Red) and DNA (Blue) were counterstained using Phalloidin 568 and DAPI.
(1 Review)
(11 Publications)
Species: Hu, Mu
Applications: ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
MUC6 Antibody
(CLH5)
NBP2-44374
Immunohistochemistry-Paraffin: MUC6 Antibody (CLH5) [NBP2-44374] - Human Gastric Carcinoma stained with MUC6 Monoclonal Antibody (CLH5).
Immunohistochemistry-Paraffin: MUC6 Antibody (CLH5) [NBP2-44374] - Formalin-fixed, paraffin-embedded human Gastric Carcinoma stained with MUC6 Antibody (CLH5). Courtesy of Dr. Leonor David, IPATIMUP and Medical Faculty, University of Porto, Portugal
(1 Publication)
Species: Hu
Applications: Flow, IHC, IHC-P, IF
MUC3 Antibody
(MUC3/1154) - Azide a ...
NBP2-47687
Immunohistochemistry-Paraffin: MUC3 Antibody (MUC3/1154) - Azide and BSA Free [NBP2-47687] - Human Colon Carcinoma stained with MUC3 Monoclonal Antibody (MUC3/1154).
Immunohistochemistry-Paraffin: MUC3 Antibody (MUC3/1154) - Azide and BSA Free [NBP2-47687] - Human Gastric Carcinoma stained with MUC3 Monoclonal Antibody (MUC3/1154).
Immunohistochemistry-Paraffin: MUC3 Antibody (MUC3/1154) - Azide and BSA Free [NBP2-47687] - Human Gastric Carcinoma stained with MUC3 Monoclonal Antibody (MUC3/1154).
Species: Hu, Rt(-)
Applications: Flow, IHC, IHC-P, CyTOF-ready, IF
Lactoferrin
Antibody (1C6)
NB120-10109
CyTOF-ready: Lactoferrin Antibody (1C6) [NB120-10109] - Human bone marrow after RBC lysis, stained with anti-CD16, fixed, permeabilized with methanol, stained with anti-lactoferrin 1C6 NB120-10109 and anti-rRNA Y10b NB100-662, and gated on myeloid cells per Nat Med. 2020. 26:408-417. CyTOF image submitted by a verified customer review.
(1 Review)
(1 Publication)
Species: Hu
Applications: WB, Flow, IHC, IHC-P, S-ELISA, CyTOF-ready
Histatin 3
Antibody (4G9)
H00003347-M01
Immunocytochemistry/Immunofluorescence: Histatin 3 Antibody (4G9) [H00003347-M01] - Analysis of monoclonal antibody to HTN3 on HeLa cell. Antibody concentration 10 ug/ml.
Sandwich ELISA: Histatin 3 Antibody (4G9) [H00003347-M01] - Detection limit for recombinant GST tagged HTN3 is approximately 3ng/ml as a capture antibody.
(1 Publication)
Species: Hu
Applications: WB, ELISA, ICC/IF, S-ELISA
Lysozyme Antibody
NBP2-61118
Western Blot: Lysozyme Antibody [NBP2-61118] - Total protein from human cell lines THP-1 and HepG2, human stomach and kidney as well as mouse kidney was separated on a 4-20% gel by SDS-PAGE, transferred to 0.2 um PVDF membrane and blocked in 5% non-fat milk in TBST. The membrane was probed with 2.0 ug/ml anti-Lysozyme in 5% non-fat milk in TBST and detected with an anti-rabbit HRP secondary antibody using chemiluminescence.
Immunocytochemistry/Immunofluorescence: Lysozyme Antibody [NBP2-61118] - HeLa cells were fixed and permeabilized for 10 minutes using -20C MeOH. The cells were incubated with anti-Lysozyme at 2 ug/ml overnight at 4C and detected with an anti-rabbit DyLight 488 (Green) at a 1:500 dilution. Alpha tubulin (DM1A) NB100-690 was used as a co-stain at a 1:1000 dilution and detected with an anti-mouse DyLight 550 (Red) at a 1:500 dilution. Nuclei were counterstained with DAPI (Blue). Cells were imaged using a 40X objective.
Immunohistochemistry-Paraffin: Lysozyme Antibody [NBP2-61118] - Analysis of a FFPE tissue section of human kidney with Lysozyme antibody at 1:100 dilution. The staining was developed with HRP-DAB detection method and the counterstaining was performed using hematoxylin. This Lysozyme antibody generated an expected cytoplasmic staining in all the cells with strongest signal in tubular epithelial cells. Some tubules showed more of a punctate staining pattern (vesicular Lysozyme) while all of the tubules depicted a diffused signal (secreted Lysozyme). A subset of cells, especially those from glomeruli, showed nuclear positivity also.
(1 Publication)
Species: Hu, Mu
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P
DMBT1/GP340
Antibody (548012)
MAB59151
Western blot shows lysates of mouse small intestine tissue. PVDF Membrane was probed with 2 µg/mL of Mouse DMBT1 Monoclonal Antibody (Catalog # MAB59151) followed by HRP-conjugated Anti-Rat IgG Secondary Antibody (Catalog # HAF005). A specific band was detected for DMBT1 at approximately 210 kDa (as indicated). This experiment was conducted under non-reducing conditions and using Immunoblot Buffer Group 1.
(2 Publications)
Species: Mu
Applications: WB
CFTR Antibody
(24-1) [Unconjugated] ...
MAB25031
CFTR was detected in immersion fixed paraffin-embedded sections of human placenta using 8 µg/mL Mouse Anti-Human CFTR C‑Terminus Monoclonal Antibody (Catalog # MAB25031) overnight at 4 °C. Tissue was stained with the Anti-Mouse HRP-AEC Cell & Tissue Staining Kit (red; Catalog # CTS003) and counterstained with hematoxylin (blue). View our protocol for Chromogenic IHC Staining of Paraffin-embedded Tissue Sections.
CFTR was detected in immersion fixed paraffin-embedded sections of human placenta using Mouse Anti-Human CFTR C-Terminus Monoclonal Antibody (Catalog # MAB25031) at 25 µg/mL overnight at 4 °C. Tissue was stained using the Anti-Mouse HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS002) and counterstained with hematoxylin (blue). Lower panel shows a lack of labeling if primary antibodies are omitted and tissue is stained only with secondary antibody followed by incubation with detection reagents. View our protocol for Chromogenic IHC Staining of Paraffin-embedded Tissue Sections.
(11 Reviews)
(40 Publications)
Species: Hu
Applications: WB, IHC, IP
MUC12 Antibody
NB200-125
MUC12 Antibody
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, IP
Cytokeratin 20
Antibody
NBP1-85599
Western Blot: Cytokeratin 20 Antibody [NBP1-85599] - Analysis in human small intestine tissue.
Immunohistochemistry-Paraffin: Cytokeratin 20 Antibody [NBP1-85599] - Analysis in human small intestine and liver tissues. Corresponding KRT20 RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: Cytokeratin 20 Antibody [NBP1-85599] - Staining of human liver shows no positivity in hepatocytes as expected
(1 Publication)
Species: Hu, Mu
Applications: WB, IHC, IHC-P
CA125/MUC16
Antibody (X75)
NB600-1468
CA125/MUC16 Antibody (X75)
(3 Publications)
Species: Hu
Applications: WB, S-ELISA
Cystatin S
Antibody (OTI2H10) - ...
NBP2-70481
Western Blot: Cystatin S Antibody (OTI2H10) - Azide and BSA Free [NBP2-70481] - HEK293T cells were transfected with the pCMV6-ENTRY control (Left lane) or pCMV6-ENTRY Cystatin S (Right lane) cDNA for 48 hrs and lysed. Equivalent amounts of cell lysates (5 ug per lane) were separated by SDS-PAGE and immunoblotted with anti-Cystatin S.
Immunocytochemistry/Immunofluorescence: Cystatin S Antibody (OTI2H10) - Azide and BSA Free [NBP2-70481] - Staining of COS7 cells transiently transfected by pCMV6-ENTRY Cystatin S.
Flow Cytometry: Cystatin S Antibody (OTI2H10) - Azide and BSA Free [NBP2-70481] - HEK293T cells transfected with either overexpression plasmid (Red) or empty vector control plasmid (Blue) were immunostaining by anti-Cystatin S antibody, and then analyzed by flow cytometry.
Species: Hu
Applications: WB, Flow, ICC/IF, CyTOF-ready
STATH Antibody
NBP1-92450
Immunohistochemistry-Paraffin: STATH Antibody [NBP1-92450] - Staining of human tonsil shows no positivity in germinal center cells as expected.
Immunohistochemistry-Paraffin: STATH Antibody [NBP1-92450] - Staining of human salivary gland shows high expression.
Immunohistochemistry-Paraffin: STATH Antibody [NBP1-92450] - Staining of human skeletal muscle shows low expression as expected.
Species: Hu
Applications: IHC, IHC-P
Recombinant Human
MUC7 GST (N-Term) Pro ...
H00004589-Q01
Recombinant Human MUC7 GST (N-Term) Protein
Species: Hu
Applications: WB, ELISA, PA, PAGE, AP

Publications for MUC7 Partial Recombinant Protein (H00004589-Q01)(1)


Reviews for MUC7 Partial Recombinant Protein (H00004589-Q01) (0)

There are no reviews for MUC7 Partial Recombinant Protein (H00004589-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for MUC7 Partial Recombinant Protein (H00004589-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Other Available Formats

Learn about Custom Antibody Labeling

Additional MUC7 Products

Bioinformatics Tool for MUC7 Partial Recombinant Protein (H00004589-Q01)

Discover related pathways, diseases and genes to MUC7 Partial Recombinant Protein (H00004589-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MUC7 Partial Recombinant Protein (H00004589-Q01)

Discover more about diseases related to MUC7 Partial Recombinant Protein (H00004589-Q01).
 

Pathways for MUC7 Partial Recombinant Protein (H00004589-Q01)

View related products by pathway.

PTMs for MUC7 Partial Recombinant Protein (H00004589-Q01)

Learn more about PTMs related to MUC7 Partial Recombinant Protein (H00004589-Q01).

Blogs on MUC7

There are no specific blogs for MUC7, but you can read our latest blog posts.

Customers Who Bought This Also Bought

CFTR was detected in immersion fixed paraffin-embedded sections of human placenta using 8 µg/mL Mouse Anti-Human CFTR C‑Terminus Monoclonal Antibody (Catalog # MAB25031) overnight at 4 °C. Tissue was stained with the Anti-Mouse HRP-AEC Cell & Tissue Staining Kit (red; Catalog # CTS003) and counterstained with hematoxylin (blue). View our protocol for Chromogenic IHC Staining of Paraffin-embedded Tissue Sections.
CFTR Antibody (24-1) [Unconjugated] - C-terminus
MAB25031
Western Blot: MUC5AC Antibody (45M1) [NBP2-15196] - AGS human gastric adenocarcinoma and KATO-III human gastric carcinoma cell line lysates. Image from verified customer review.
MUC5AC Antibody (45M1)
NBP2-15196-0.1mg

Contact Information

Product PDFs

  PDF Datasheet
  Request CofA
  Request SDS

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human MUC7 GST (N-Term) Protein and receive a gift card or discount.


Bioinformatics

Gene Symbol MUC7