Recombinant Human MUC5B GST (N-Term) Protein Summary
| Description |
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 4186-4295 of Human Mucin 5B Source: Wheat Germ (in vitro) Amino Acid Sequence: CEEDSCQVRINTTILWHQGCETEVNITFCEGSCPGASKYSAEAQAMQHQCTCCQERRVHEETVPLHCPNGSAILHTYTHVDECGCTPFCVPAPMAPPHTRGFPAQEATAV |
Preparation Method |
in vitro wheat germ expression system |
| Details of Functionality |
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated. |
| Source |
Wheat germ |
| Protein/Peptide Type |
Recombinant Protein |
| Gene |
MUC5B |
| Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Applications/Dilutions
| Dilutions |
- ELISA
- Immunoaffinity Purification
- Protein Array
- SDS-Page
- Western Blot
|
| Theoretical MW |
37.84 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
| Publications |
|
Packaging, Storage & Formulations
| Storage |
Store at -80C. Avoid freeze-thaw cycles. |
| Buffer |
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer. |
| Preservative |
No Preservative |
| Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Notes
This product is produced by and distributed for Abnova, a company based in Taiwan.
Alternate Names for Recombinant Human MUC5B GST (N-Term) Protein
Background
MUC5B - mucin 5, subtype B, tracheobronchial
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Bv(-), Ch, Fe, Hu, Ma, Pm, Mu, Po, Rb, Rt
Applications: DB, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, WB
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF (-), IHC, IHC-Fr, IHC-P, WB
Species: Hu, Mu
Applications: ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu
Applications: ELISA, IHC, IHC-P, WB
Species: Hu
Applications: Flow, ICC/IF, IF, IHC, IHC-P, IP, WB
Species: Hu, Rt(-)
Applications: Flow, ICC/IF, IF, IHC, IHC-P
Species: Hu
Applications: IHC, IP, WB
Species: Hu
Applications: BA
Species: Mu
Applications: ELISA
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ELISA(Cap), ELISA(Det), ELISA(Sta), Flow, ICC, IHC, IP, Simple Western, WB
Species: Hu, Mu, Rt
Applications: ELISA
Species: Mu
Applications: WB
Species: Hu
Applications: CyTOF-ready, IHC, IHC-P, S-ELISA, WB
Species: Ca, Fe, Hu, Mu
Applications: Dual ISH-IHC, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu, Mu
Applications: Flow, ICC/IF, IHC, IHC-P, Simple Western, WB
Species: Hu
Applications: Bind
Species: Hu
Applications: IHC, IHC-P
Publications for MUC5B Partial Protein (H00727897-Q01)(1)
Showing Publication 1 -
1 of 1.
Reviews for MUC5B Partial Protein (H00727897-Q01) (0)
There are no reviews for MUC5B Partial Protein (H00727897-Q01).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for MUC5B Partial Protein (H00727897-Q01). (Showing 1 - 2 of 2 FAQ).
-
I recently bought several recombinant human mucins from your company, Mucin 4--cat# H00004585-Q01, mucin 5b--cat# H00727897-Q01, mucin 5ac--cat # H00004586-Q01. I would like to know what cell lines were used to make these recombinant proteins and whether they are glycosylated.
- The proteins you inquired about were produced in the wheat germ protein expression system which is a cell free protein synthesis system. This system does not allow protein glycosylation. Please view more details about Abnova's cell free protein synthesis system (http://www.abnova.com/support/technologies.asp?switchfunctionid={539614B1-7CBB-4068-A93B-1B44DC6F2801})
-
I'm interested in your company's product this human recombinant MUC5b protein. 1) Did you artificially make this from bacteria like something? 2) Your data sheet mentioned that this protein is not useful to measure activity. Is this protein composed by only core protein or is this product have glycocilation area?
- This product is distributed by us for a Taiwanese company called Abnova. They do not test the activity of their recombinant proteins. The proteins are produced in a cell-free wheat germ system with an N-terminal 26kDa GST-tag. Due to this expression system, in our experience, the proteins do not always undergo the same folding and post-translational modifications they might undergo in an endogenous cell. Because of this, we do not recommend this protein for use in functional assays and do not guarantee them for this use. They are mainly intended for use in Western Blots as a positive control with their antibody.
Additional MUC5B Products
Research Areas for MUC5B Partial Protein (H00727897-Q01)
Find related products by research area.
|
Blogs on MUC5B