MUC21 Antibody


Immunohistochemistry-Paraffin: MUC21 Antibody [NBP2-31023] - Staining of human stomach shows strong cytoplasmic positivity in parietal cells
Immunohistochemistry-Paraffin: MUC21 Antibody [NBP2-31023] - Staining of human esophagus shows moderate membranous positivity in squamous epithelial cells.
Immunohistochemistry-Paraffin: MUC21 Antibody [NBP2-31023] - Staining of human skeletal muscle shows no positivity in myocytes.

Product Details

Reactivity HuSpecies Glossary
Applications IHC, IHC-P

Order Details

MUC21 Antibody Summary

This antibody was developed against a recombinant protein corresponding to amino acids: CVRNSLSLRNTFNTAVYHPHGLNHGLGPGPGGNHGAPHRPRWSPNWFWRRPVSSIAMEMSGRNS
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:5000 - 1:10000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
MUC21 Protein (NBP2-31023PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for MUC21 Antibody

  • bCX31G15.2
  • C6orf205
  • Chromosome 6 Open Reading Frame 205
  • epiglycanin
  • KMQK697
  • MUC-21
  • Mucin 21, Cell Surface Associated
  • mucin-21


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Rt, Po, Ha, Pm
Applications: IHC-P
Species: Hu, Mu, Rt, Ca, Mk
Applications: WB, IF
Species: Hu, Po, Rb
Applications: WB, B/N, ELISA, ICC/IF, IHC, IHC-P, RIA
Species: Hu
Applications: WB, IHC, IHC-P
Species: Mu
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu, Mu
Applications: WB, Flow, IHC, IHC-Fr, IHC-P
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP

Publications for MUC21 Antibody (NBP2-31023) (0)

There are no publications for MUC21 Antibody (NBP2-31023).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MUC21 Antibody (NBP2-31023) (0)

There are no reviews for MUC21 Antibody (NBP2-31023). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for MUC21 Antibody (NBP2-31023) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional MUC21 Products

MUC21 NBP2-31023

Bioinformatics Tool for MUC21 Antibody (NBP2-31023)

Discover related pathways, diseases and genes to MUC21 Antibody (NBP2-31023). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MUC21 Antibody (NBP2-31023)

Discover more about diseases related to MUC21 Antibody (NBP2-31023).

Pathways for MUC21 Antibody (NBP2-31023)

View related products by pathway.

PTMs for MUC21 Antibody (NBP2-31023)

Learn more about PTMs related to MUC21 Antibody (NBP2-31023).

Blogs on MUC21

There are no specific blogs for MUC21, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our MUC21 Antibody and receive a gift card or discount.


Gene Symbol MUC21