![Immunohistochemistry-Paraffin: MUC21 Antibody [NBP2-31023] - Staining in human esophagus and skeletal muscle tissues . Corresponding MUC21 RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/MUC21-Antibody-Immunohistochemistry-Paraffin-NBP2-31023-img0010.jpg "Immunohistochemistry-Paraffin: MUC21 Antibody [NBP2-31023] - Staining in human esophagus and skeletal muscle tissues . Corresponding MUC21 RNA-seq data are presented for the same tissues.")
| Reactivity | HuSpecies Glossary |
| Applications | IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Format | BSA Free |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: CVRNSLSLRNTFNTAVYHPHGLNHGLGPGPGGNHGAPHRPRWSPNWFWRRPVSSIAMEMSGRNS |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | MUC21 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
||
| Control Peptide |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
![Immunocytochemistry E-Cadherin Antibody [Unconjugated]](https://images.novusbio.com/images2/ECadherin_AF748_Immunocytochemistry_15885.jpg)
![Immunohistochemistry E-Cadherin Antibody [Unconjugated]](https://images.novusbio.com/images2/ECadherin_AF748_Immunohistochemistry_15886.jpg)
![Immunocytochemistry E-Cadherin Antibody [Unconjugated]](https://images.novusbio.com/images2/ECadherin_AF748_Immunocytochemistry_16572.jpg)
| Publication using NBP2-31023 | Applications | Species |
|---|---|---|
| Akimori T, Yamazaki M, Abé T et al. Searching for new early detection markers of oral epithelial dysplasia and oral squamous cell carcinoma using oral liquid-based cytology Journal of Oral and Maxillofacial Surgery, Medicine, and Pathology 2023-11-01 |
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![Immunohistochemistry-Paraffin: MUC21 Antibody [NBP2-31023] - Staining of human esophagus shows moderate membranous positivity in squamous epithelial cells.](http://images.novusbio.com/fullsize/MUC21-Antibody-Immunohistochemistry-Paraffin-NBP2-31023-img0007.jpg "Immunohistochemistry-Paraffin: MUC21 Antibody [NBP2-31023] - Staining of human esophagus shows moderate membranous positivity in squamous epithelial cells.")
![Immunohistochemistry-Paraffin: MUC21 Antibody [NBP2-31023] - Staining of human skeletal muscle shows no positivity in myocytes.](http://images.novusbio.com/fullsize/MUC21-Antibody-Immunohistochemistry-Paraffin-NBP2-31023-img0008.jpg "Immunohistochemistry-Paraffin: MUC21 Antibody [NBP2-31023] - Staining of human skeletal muscle shows no positivity in myocytes.")
![Immunohistochemistry-Paraffin: MUC21 Antibody [NBP2-31023] - Staining of human stomach shows strong cytoplasmic positivity in parietal cells.](http://images.novusbio.com/fullsize/MUC21-Antibody-Immunohistochemistry-Paraffin-NBP2-31023-img0009.jpg "Immunohistochemistry-Paraffin: MUC21 Antibody [NBP2-31023] - Staining of human stomach shows strong cytoplasmic positivity in parietal cells.")
![N/A Coagulation Factor III/Tissue Factor [HRP]](https://images.novusbio.com/images2/DATA_Coagulation_Factor_III_DCF300_ELISA_625.jpg)
![N/A Coagulation Factor III/Tissue Factor [HRP]](https://images.novusbio.com/images2/Coagulation_Factor_III_DCF300_ELISA_61.jpg)
![Immunohistochemistry EphA3 Antibody [Unconjugated]](https://images.novusbio.com/images2/EphA3_AF640_Immunohistochemistry_19184.jpg)
![N/A Kallikrein 3/PSA [HRP]](https://images.novusbio.com/images2/DATA_Kallikrein_3_DKK300_ELISA_729.jpg)
![N/A Kallikrein 3/PSA [HRP]](https://images.novusbio.com/images2/DATA_Kallikrein_3_DKK300_ELISA_730.jpg)
![N/A Kallikrein 3/PSA [HRP]](https://images.novusbio.com/images2/Kallikrein_3_DKK300_ELISA_124.jpg)
![Flow Cytometry EpCAM/TROP1 Antibody [Unconjugated]](https://images.novusbio.com/images2/EpCAM_AF960_Flow_Cytometry_15685.jpg)
![Immunohistochemistry EpCAM/TROP1 Antibody [Unconjugated]](https://images.novusbio.com/images2/EpCAM_AF960_Immunohistochemistry_23512.jpg)
![Immunohistochemistry EpCAM/TROP1 Antibody [Unconjugated]](https://images.novusbio.com/images2/EpCAM_AF960_Immunohistochemistry_23513.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")