Recombinant Human MTTP Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human MTTP Protein Summary

Description
MTTP (Human) GST-Tagged Recombinant Protein (Q01)

Source: Wheat Germ (in vitro)

Amino Acid Sequence: SSFVKAGLETSTETEAGLEFISTVQFSQYPFLVCMQMDKDEAPFRQFEKKYERLSTGRGYVSQKRKESVLAGCEFPLHQENSEMCKVVFAPQPDSTSSGWF
Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
MTTP

Applications/Dilutions

Application Notes
Useful in Western Blot and ELISA. This protein has not been tested for any functionality. This product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human MTTP Protein

  • 88kD)
  • 88kDa)
  • ABL
  • MGC149819
  • microsomal triglyceride transfer protein large subunit
  • microsomal triglyceride transfer protein
  • MTPMGC149820

Background

MTP encodes the large subunit of the heterodimeric microsomal triglyceride transfer protein. Protein disulfide isomerase (PDI) completes the heterodimeric microsomal triglyceride transfer protein, which has been shown to play a central role in lipoprotein assembly. Mutations in MTP can cause abetalipoproteinemia. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-19097
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, PLA
AF5414
Species: Hu
Applications: WB, Simple Western
AF2685
Species: Hu
Applications: WB, Simple Western, IHC
NB200-527
Species: Hu, Mu
Applications: WB, RI
AF1356
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP
NBP2-34294
Species: Hu, Mu, Rt
Applications: WB, Flow, IHC-P
NB600-335
Species: Hu, Mu, Ec, NA
Applications: WB, ELISA, ICC/IF, IHC-Fr, IP
NB100-56749
Species: Hu, Mu
Applications: WB, IHC, IHC-P
AF2988
Species: Mu, Rt
Applications: WB
NBP1-80695
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IF
NB600-1071
Species: Mu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NB300-558
Species: Hu, Rb
Applications: WB, ELISA, ICC/IF, IP
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready

Publications for MTTP Partial Recombinant Protein (H00004547-Q01) (0)

There are no publications for MTTP Partial Recombinant Protein (H00004547-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MTTP Partial Recombinant Protein (H00004547-Q01) (0)

There are no reviews for MTTP Partial Recombinant Protein (H00004547-Q01). By submitting a review earn points towards our Rewards Program.
  • 250 points for product review
  • 500 additional points for an image with your product review
  • Double points (500) if you are the first to review this product
  • Double points (1000) if you are the first to review this product with an image

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for MTTP Partial Recombinant Protein (H00004547-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Recombinant Human MTTP Protein Products

Related Products by Gene

Bioinformatics Tool for MTTP Partial Recombinant Protein (H00004547-Q01)

Discover related pathways, diseases and genes to MTTP Partial Recombinant Protein (H00004547-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MTTP Partial Recombinant Protein (H00004547-Q01)

Discover more about diseases related to MTTP Partial Recombinant Protein (H00004547-Q01).
 

Pathways for MTTP Partial Recombinant Protein (H00004547-Q01)

View related products by pathway.

PTMs for MTTP Partial Recombinant Protein (H00004547-Q01)

Learn more about PTMs related to MTTP Partial Recombinant Protein (H00004547-Q01).

Blogs on MTTP

There are no specific blogs for MTTP, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human MTTP Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol MTTP

Customers Who Bought This Also Bought

c-Myc Antibody
NB600-335
c-Myc Antibody
NB600-335
MTTP Antibody
NBP2-49154