MTTP Partial Recombinant Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

MTTP Partial Recombinant Protein Summary

Description
MTTP (Human) GST-Tagged Recombinant Protein (Q01)

Source: Wheat Germ (in vitro)

Amino Acid Sequence: SSFVKAGLETSTETEAGLEFISTVQFSQYPFLVCMQMDKDEAPFRQFEKKYERLSTGRGYVSQKRKESVLAGCEFPLHQENSEMCKVVFAPQPDSTSSGWF
Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Gene
MTTP

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Conjugate
Unconjugated
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Applications/Dilutions

Application Notes
Useful in Western Blot and ELISA. This protein has not been tested for any functionality. This product may contain endotoxins and is not suitable for use with live cells.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for MTTP Partial Recombinant Protein

  • 88kD)
  • 88kDa)
  • ABL
  • MGC149819
  • microsomal triglyceride transfer protein large subunit
  • microsomal triglyceride transfer protein
  • MTPMGC149820

Background

MTP encodes the large subunit of the heterodimeric microsomal triglyceride transfer protein. Protein disulfide isomerase (PDI) completes the heterodimeric microsomal triglyceride transfer protein, which has been shown to play a central role in lipoprotein assembly. Mutations in MTP can cause abetalipoproteinemia. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-19097
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, PLA
NSB252
Species: Hu, Rt
Applications: WB
MAB2685
Species: Hu
Applications: WB, Simple Western, ICC
AF1356
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC
NBP2-34294
Species: Hu, Mu, Rt
Applications: WB, Flow, IHC-P
NB600-302
Species: Hu, Mu, Dr
Applications: WB, Simple Western, ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
MAB2055
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC, ICFlow
NBP1-22975
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-80695
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB600-1071
Species: Mu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP1-45478
Species: Hu, Mu, Rt, Rb
Applications: WB, IHC
MAB3429
Species: Hu
Applications: WB
MAB1489
Species: Hu
Applications: WB
H00004547-Q01
Species: Hu
Applications: WB, ELISA, PA

Publications for MTTP Partial Recombinant Protein (H00004547-Q01) (0)

There are no publications for MTTP Partial Recombinant Protein (H00004547-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MTTP Partial Recombinant Protein (H00004547-Q01) (0)

There are no reviews for MTTP Partial Recombinant Protein (H00004547-Q01). By submitting a review earn points towards our Rewards Program.
  • 250 points for product review
  • 500 additional points for an image with your product review
  • Double points (500) if you are the first to review this product
  • Double points (1000) if you are the first to review this product with an image

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for MTTP Partial Recombinant Protein (H00004547-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional MTTP Partial Recombinant Protein Products

Related Products by Gene

Bioinformatics Tool for MTTP Partial Recombinant Protein (H00004547-Q01)

Discover related pathways, diseases and genes to MTTP Partial Recombinant Protein (H00004547-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MTTP Partial Recombinant Protein (H00004547-Q01)

Discover more about diseases related to MTTP Partial Recombinant Protein (H00004547-Q01).
 

Pathways for MTTP Partial Recombinant Protein (H00004547-Q01)

View related products by pathway.

PTMs for MTTP Partial Recombinant Protein (H00004547-Q01)

Learn more about PTMs related to MTTP Partial Recombinant Protein (H00004547-Q01).

Blogs on MTTP

There are no specific blogs for MTTP, but you can read our latest blog posts.

Contact Information

Product PDFs

Bioinformatics

Gene Symbol MTTP

Customer Resources

Novus Review - Submit your review and earn rewards points which can be used for merchandise & discounts.
Risk Free Testing - Test on a species/application not listed above to receive a full credit towards a future purchase.

Novus' Quality Guarantee - Novus guarantees that every product we sell will work in the application and species listed on our website and datasheets.

Submit your question on H00004547-Q01 below.
During business hours, we will respond to your email within 24 hours. For any questions submitted on the weekend, a response will be received on Monday.
For immediate assistance during business hours M- F (excluding major holidays), please contact us.
Ask a Scientist - We have a lab full of white coats just waiting for your scientific questions and concerns.

Customers Who Bought This Also Bought

MTTP Recombinant Protein
H00004547-P01-10ug
MTTP Antibody
NBP1-18783