mtTFA Antibody

Western Blot: mtTFA Antibody [H00007019-D01P] - Analysis of TFAM expression in mouse liver.

Western Blot: mtTFA Antibody [H00007019-D01P] - analysis of TFAM expression in transfected 293T cell line by TFAM MaxPab rabbit polyclonal antibody. Lane 1: TFAM transfected lysate (29.10 KDa). Lane 2: Non-transfected lysate.

Western Blot: mtTFA Antibody [H00007019-D01P] - Analysis of TFAM expression in transfected 293T cell line by TFAM polyclonal antibody.Lane 1: TFAM transfected lysate(29.10 KDa).Lane 2: Non-transfected lysate.

Product Discontinued

mtTFA Antibody Summary

• Description: Quality control test: Antibody reactive against mammalian transfected lysate.
• Immunogen: TFAM (NP_003192.1, 1 a.a. - 246 a.a.) full-length human protein. MAFLRSMWGVLSALGRSGAELCTGCGSRLRSPFSFVYLPRWFSSVLASCPKKPVSSYLRFSKEQLPIFKAQNPDAKTTELIRRIAQRWRELPDSKKKIYQDAYRAEWQVYKEEISRFKEQLTPSQIMSLEKEIMDKHLKRKAMTKKKELTLLGKPKRPRSAYNVYVAERFQEAKGDSPQEKLKTVKENWKNLSDSEKELYIQHAKEDETRYHNEMKSWEEQMIEVGRKDLLRRTIKKQRKYGAEEC
• Specificity: Reacts with transcription factor A, mitochondrial.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: TFAM
• Purity: Protein A purified

Applications/Dilutions

• Dilutions:
  • Western Blot
• Application Notes: This antibody is reactive against tissue and transfected lysate in WB and as a detection antibody in ELISA.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.4)
• Preservative: No Preservative
• Purity: Protein A purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for mtTFA Antibody

• mitochondrial transcription factor A
• MtTF1
• mtTFA
• TCF-6
• TCF6L1
• TCF6L2Mitochondrial transcription factor 1
• TCF6TCF6L3
• Transcription factor 6
• Transcription factor 6-like 2 (mitochondrial transcription factor)
• Transcription factor 6-like 2
• transcription factor A, mitochondrial

Background

This gene encodes a mitochondrial transcription factor that is a key activator of mitochondrial transcription as well as a participant in mitochondrial genome replication. Studies in mice have demonstrated that this gene product is required to regulate the mitochondrial genome copy number and is essential for embryonic development. A mouse model for Kearns-Sayre syndrome was produced when expression of this gene was eliminated by targeted disruption in heart and muscle cells. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for mtTFA Antibody (H00007019-D01P)(4)

Publications using H00007019-D01P

• Radde BN, Ivanova MM, Mai MX et al. Nuclear respiratory factor-1 and bioenergetics in tamoxifen-resistant breast cancer cells. Experimental Cell Research 2016-08-08 [PMID: 27515002]
• Petrov D, Luque M, Pedros I et al. Evaluation of the Role of JNK1 in the Hippocampus in an Experimental Model of Familial Alzheimers Disease. Mol Neurobiol 2015-11-12 [PMID: 26558630]
• Ortiz F, Acuna-Castroviejo D, Doerrier C et al. Melatonin blunts the mitochondrial/NLRP3 connection and protects against radiation-induced oral mucositis. J Pineal Res. 2014-11-07 [PMID: 25388914]
• Ivanova MM, Radde BN, Son J, Mehta FF et al. Estradiol and tamoxifen regulate NRF-1 and mitochondrial function in mouse mammary gland and uterus. Society for Endocronology. 2010-09-10 [PMID: 23892277]

Bioinformatics

• Gene Symbol: TFAM
• Entrez:
  • 7019(Human)
• Uniprot:
  • NP_003192.1(Human)