MTHFD2 Antibody [mFluor Violet 450 SE]

Product Discontinued

MTHFD2 Antibody [mFluor Violet 450 SE] Summary

• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 40-250 of human MTHFD2 (NP_006627.2).
  
  Sequence:
  ISGRKLAQQIKQEVRQEVEEWVASGNKRPHLSVILVGENPASHSYVLNKTRAAAVVGINSETIMKPASISEEELLNLINKLNNDDNVDGLLVQLPLPEHIDERRICNAVSPDKDVDGFHVINVGRMCLDQYSMLPATPWGVWEIIKRTGIPTLGKNVVVAGRSKNVGMPIAMLLHTDGAHERPGGDATVTISHRYTPKEQLKKHTILADIV
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: MTHFD2
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunocytochemistry/ Immunofluorescence
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin
  • Western Blot
• Application Notes: Optimal dilution of this antibody should be experimentally determined.

Packaging, Storage & Formulations

• Storage: Store at 4C in the dark.
• Buffer: 50mM Sodium Borate
• Preservative: 0.05% Sodium Azide
• Purity: Affinity purified

Notes

mFluor(TM) is a trademark of AAT Bioquest, Inc. This conjugate is made on demand. Actual recovery may vary from the stated volume of this product. The volume will be greater than or equal to the unit size stated on the datasheet.

Alternate Names for MTHFD2 Antibody [mFluor Violet 450 SE]

• bifunctional methylenetetrahydrofolate dehydrogenase/cyclohydrolase
• methenyltetrahydrofolate cyclohydrolase
• methylene tetrahydrofolate dehydrogenase (NAD+ dependent)
• methylenetetrahydrofolate dehydrogenase (NADP+ dependent) 2
• mitochondrial
• NAD-dependent methylene tetrahydrofolate dehydrogenase cyclohydrolase
• NMDMC

Background

MTHFD2 encodes a nuclear-encoded mitochondrial bifunctional enzyme with methylenetetrahydrofolate dehydrogenase and methenyltetrahydrofolate cyclohydrolase activities. The enzyme functions as a homodimer and is unique in its absolute requirement for magnesium and inorganic phosphate. Formation of the enzyme-magnesium complex allows binding of NAD. Alternative splicing results in multiple transcripts encoding different isoforms. This gene has a pseudogene on chromosome 7.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: MTHFD2