We're moving to rndsystems.com. Come with us!

After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.

MTHFD1L Recombinant Protein Antigen

Images

 
There are currently no images for MTHFD1L Protein (NBP2-37864PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

MTHFD1L Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human MTHFD1L.

Source: E. coli

Amino Acid Sequence: HFGGLIEEDDVILLAAALRIQNMVSSGRRWLREQQHRRWRLHCLKLQPLSPVPSDIEISRGQTPKAVDVLAKEIGLLADEIEIYGKSKAKV

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
MTHFD1L
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-37864.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
28 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for MTHFD1L Recombinant Protein Antigen

  • 10-formyl-THF synthetase
  • dJ292B18.2
  • DKFZp586G1517
  • EC 6.3.4.3
  • FLJ21145
  • formyltetrahydrofolate synthetase domain containing 1
  • Formyltetrahydrofolate synthetase
  • FTHFSDC1
  • methylenetetrahydrofolate dehydrogenase (NADP+ dependent) 1-like
  • mitochondrial C1-tetrahydrofolate synthase
  • mitochondrial C1-tetrahydrofolate synthetase
  • monofunctional C1-tetrahydrofolate synthase, mitochondrial
  • MTC1THFS

Background

MTHFD1L, also known as Monofunctional C1-tetrahydrofolate synthase, mitochondrial, consists of 2 a 978 amino acid isoform1 that is 106 kDa and a 275 amino acid isoform 2 that is 30 kDa; has mitochondrion subcellular location and highest expression found in placenta, thymus and brain; it is involved in the synthesis of tetrahydrofolate (THF) in the mitochondrion which is important in the de novo synthesis of purines and thymidylate and in the regeneration of methionine from homocysteine, and also may provide the missing metabolic reaction required to link the mitochondria and the cytoplasm in the mammalian model of one-carbon folate metabolism in embryonic an transformed cells complementing thus the enzymatic activities of MTHFD2. Current research is being performed on this protein involvement in cleft lip/palate, neural tube defect, homocysteine, coronary heart disease, chronic myeloid leukemia, Down syndrome, colon adenocarcinoma, nephropathy, Alzheimer's disease, dementia, colorectal cancer, leukemia, and atherosclerosis. This protein plays role in One carbon pool by folate and Metabolic pathways where it interacts with CASP4, MAGED1, WRAP73, WDR8, MAP1LC3A, and plus more than 40 other proteins.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-82612
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, WB
NB110-60531
Species: Hu, Mu, Rt(-)
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC,  IHC-P, IP, WB
350-NS
Species: Fe, Hu, RM
Applications: BA
NBP1-33200
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, IP, WB
AF2934
Species: Mu
Applications: Block, IHC, Simple Western, WB
NBP2-33770
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-81838
Species: Hu
Applications: IHC,  IHC-P, WB
NBP1-88057
Species: Hu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-77836
Species: Hu, Mu
Applications: ELISA, Flow, ICC/IF, IHC,  IHC-P, Single-Cell Western, WB
NB200-106
Species: Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-Fr,  IHC-P, WB
AF7197
Species: Hu, Mu
Applications: ICC, IHC, WB
NBP2-43790
Species: Hu
Applications: ICC/IF, WB
MPC900
Species: Mu
Applications: ELISA
NBP2-73636
Species: Ca, Hu, Pm, Mu, Pm, Rt
Applications: CyTOF-ready, Flow, WB
NBP1-59904
Species: Hu
Applications: IHC,  IHC-P, WB
AF2255
Species: Mu
Applications: Block, CyTOF-ready, Flow, IHC, WB
NBP2-66888
Species: Hu, Mu, Rt
Applications:  IHC-P, IP, Simple Western, WB
AF4885
Species: Mu
Applications: IP, WB
NBP1-69703
Species: Hu
Applications: WB
NBP2-37864PEP
Species: Hu
Applications: AC

Publications for MTHFD1L Protein (NBP2-37864PEP) (0)

There are no publications for MTHFD1L Protein (NBP2-37864PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MTHFD1L Protein (NBP2-37864PEP) (0)

There are no reviews for MTHFD1L Protein (NBP2-37864PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for MTHFD1L Protein (NBP2-37864PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional MTHFD1L Products

Array NBP2-37864PEP

Blogs on MTHFD1L

There are no specific blogs for MTHFD1L, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our MTHFD1L Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol MTHFD1L