Recombinant Human MTHFD1L Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human MTHFD1L Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 801-899 of Human MTHFD1L partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:VFKTDTRAEIDLVCELAKRAGAFDAVPCYHWSVGGKGSVDLARAVREAASKRSRFQFLYDVQVPIVDKIRTIAQAVYGAKDIELSPEAQAKIDRYTQQG

Protein/Peptide Type
Partial Recombinant Protein
Gene
MTHFD1L

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human MTHFD1L Protein

  • 10-formyl-THF synthetase
  • dJ292B18.2
  • DKFZp586G1517
  • EC 6.3.4.3
  • FLJ21145
  • formyltetrahydrofolate synthetase domain containing 1
  • Formyltetrahydrofolate synthetase
  • FTHFSDC1
  • methylenetetrahydrofolate dehydrogenase (NADP+ dependent) 1-like
  • mitochondrial C1-tetrahydrofolate synthase
  • mitochondrial C1-tetrahydrofolate synthetase
  • monofunctional C1-tetrahydrofolate synthase, mitochondrial
  • MTC1THFS

Background

MTHFD1L - methylenetetrahydrofolate dehydrogenase (NADP+ dependent) 1-like

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-82612
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NB110-60531
Species: Hu, Mu, Rt(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, IP, CyTOF-ready
NBP1-33200
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
AF2934
Species: Mu
Applications: WB, Simple Western, IHC, Block
NBP2-33770
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-81838
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-88057
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-77836
Species: Hu, Mu, Rt, Po, Bv, Ch, Xp, Ze
Applications: WB, ELISA, Flow, IHC, IHC-P
NB200-106
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
AF7197
Species: Hu, Mu
Applications: WB, IHC, ICC
NBP2-43790
Species: Hu
Applications: WB
NBP2-31364
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-01808
Species: Hu, Mu, Rt, Ca, Pm
Applications: WB, Flow
NBP1-59904
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-78159
Species: Hu, Rt, Po, Bv
Applications: WB, EM, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, In vitro, RIA
NBP1-91996
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
AF4885
Species: Mu
Applications: WB, IP
NBP1-86943
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00025902-Q01
Species: Hu
Applications: WB, ELISA, PA

Publications for MTHFD1L Partial Recombinant Protein (H00025902-Q01) (0)

There are no publications for MTHFD1L Partial Recombinant Protein (H00025902-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MTHFD1L Partial Recombinant Protein (H00025902-Q01) (0)

There are no reviews for MTHFD1L Partial Recombinant Protein (H00025902-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for MTHFD1L Partial Recombinant Protein (H00025902-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional MTHFD1L Products

Bioinformatics Tool for MTHFD1L Partial Recombinant Protein (H00025902-Q01)

Discover related pathways, diseases and genes to MTHFD1L Partial Recombinant Protein (H00025902-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MTHFD1L Partial Recombinant Protein (H00025902-Q01)

Discover more about diseases related to MTHFD1L Partial Recombinant Protein (H00025902-Q01).
 

Pathways for MTHFD1L Partial Recombinant Protein (H00025902-Q01)

View related products by pathway.

PTMs for MTHFD1L Partial Recombinant Protein (H00025902-Q01)

Learn more about PTMs related to MTHFD1L Partial Recombinant Protein (H00025902-Q01).

Blogs on MTHFD1L

There are no specific blogs for MTHFD1L, but you can read our latest blog posts.

Customers Who Bought This Also Bought

MTHFD1L Antibody
NBP2-37863
p19ARF Antibody
NB200-106

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human MTHFD1L Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol MTHFD1L