MST2/STK3 Antibody - BSA Free

Western Blot: MST2/STK3 Antibody [NBP1-89586] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.

Immunocytochemistry/Immunofluorescence: MST2/STK3 Antibody [NBP1-89586] - Staining of human cell line U-2 OS shows localization to rods & rings. Antibody staining is shown in green.

Immunohistochemistry-Paraffin: MST2/STK3 Antibody [NBP1-89586] - Staining of human breast shows strong cytoplasmic and membranous positivity in glandular cells.

Western Blot: MST2/STK3 Antibody [NBP1-89586] - Analysis in human cell line HEK 293.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

MST2/STK3 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: ATSTMSEGAQTMIEHNSTMLESDLGTMVINSEDEEEEDGTMKRNATSPQVQRPSFMDYFDKQDFKNKSHENCNQNMHEPFPMSKNVFPDNWKVPQDGDFDFLKNLSLEELQMRLKALDPMMEREI
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: STK3
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  MST2/STK3 Protein (NBP1-89586PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for MST2/STK3 Antibody - BSA Free

• EC 2.7.11
• FLJ90748
• KRS1
• Mammalian STE20-like protein kinase 2
• Mess1
• MST2
• MST-2
• MST2EC 2.7.11.1
• MST3
• serine/threonine kinase 3 (STE20 homolog, yeast)
• serine/threonine kinase 3 (Ste20, yeast homolog)
• serine/threonine kinase 3
• serine/threonine-protein kinase 3
• Serine/threonine-protein kinase Krs-1
• STE20-like kinase MST2
• STK3

Background

Mammalian Sterile 20-Like 2 (Mst2) is most similar to the previously identified Mst1 protein kinase (78% identity, 88% similarity). Northern analysis indicates that MST2 mRNA is expressed at high levels in adult kidney, skeletal and placental tissues and at very low levels in adult heart, lung, liver and brain tissues. An in-vitro kinase assay indicates that Mst2 can phosphorylate an exogenous substrate, as well as itself, and phospho-amino-acid analysis indicates that it is a serine/threonine protein kinase (1) Mst2, a STE20-family member and purported Hpo ortholog, phosphorylates and activates both Lats1 and Lats2. Results indicate that Mst2-like kinases regulate Lats kinase activities in an evolutionarily conserved regulatory pathway (2). When stably expressed in HeLa cells, Mst highly sensitizes the cells to death receptor-mediated apoptosis by accelerating caspase-3 activation. These findings suggest that Mst1 and Mst2 play a role in apoptosis both upstream and downstream of caspase activation (3).

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: STK3