MSK2 Antibody - Azide and BSA Free

Western Blot: MSK2 Antibody [NBP2-93168] - Western blot analysis of extracts of U-87MG cells, using MSK2 antibody (NBP2-93168) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 180s.

Immunohistochemistry-Paraffin: MSK2 Antibody [NBP2-93168] - Paraffin-embedded mouse lung using MSK2 .

• Reactivity: Hu, Mu
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: Azide and BSA Free

MSK2 Antibody - Azide and BSA Free Summary

• Description: Novus Biologicals Rabbit MSK2 Antibody - Azide and BSA Free (NBP2-93168) is a polyclonal antibody validated for use in IHC and WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 673-772 of human MSK2 (NP_003933.1). WLQDGSARSSPPLRTPDVLESSGPAVRSGLNATFMAFNRGKREGFFLKSVENAPLAKRRKQKLRSATASRRGSPAPANPGRAPVASKGAPRRANGPLPPS
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: RPS6KA4
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:20-1:100
  • Immunohistochemistry-Paraffin
  • Western Blot 1:500 - 1:1000

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol
• Preservative: 0.05% Proclin 300
• Purity: Affinity purified

Alternate Names for MSK2 Antibody - Azide and BSA Free

• MSK2
• ribosomal protein S6 kinase, 90kDa, polypeptide 4
• RPS6KA4
• RSKB

Background

The p90 ribosomal S6 kinases (RSK)1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: RPS6KA4