MSK2 Antibody - Azide and BSA Free Summary
| Immunogen |
A synthetic peptide corresponding to a sequence within amino acids 673-772 of human MSK2 (NP_003933.1). WLQDGSARSSPPLRTPDVLESSGPAVRSGLNATFMAFNRGKREGFFLKSVENAPLAKRRKQKLRSATASRRGSPAPANPGRAPVASKGAPRRANGPLPPS |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
RPS6KA4 |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Immunohistochemistry 1:20-1:100
- Immunohistochemistry-Paraffin
- Western Blot 1:500 - 1:1000
|
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.3), 50% glycerol |
| Preservative |
0.02% Sodium Azide |
| Purity |
Affinity purified |
Alternate Names for MSK2 Antibody - Azide and BSA Free
Background
The p90 ribosomal S6 kinases (RSK)1
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu
Applications: ICC, WB
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
Species: Hu, Mu, Rt
Applications: ELISA
Species: Hu, Mu, Rt
Applications: ELISA
Species: Hu
Applications: BA
Species: Hu, Mu, Rt
Applications: IHC, KO, Simple Western, WB
Species: Hu, Mu
Applications: ICC/IF, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, I, Mu, Rt, Xp, Ye
Applications: ChIP, IB, ICC/IF, IHC, IHC-P, Single-Cell Western, WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: IHC, Simple Western, WB
Species: Hu
Applications: BA
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: PEP-ELISA, WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, S-ELISA, WB
Publications for MSK2 Antibody (NBP2-93168) (0)
There are no publications for MSK2 Antibody (NBP2-93168).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for MSK2 Antibody (NBP2-93168) (0)
There are no reviews for MSK2 Antibody (NBP2-93168).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for MSK2 Antibody (NBP2-93168) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional MSK2 Products
Research Areas for MSK2 Antibody (NBP2-93168)
Find related products by research area.
|
Blogs on MSK2