MS4A7 Antibody - BSA Free

Western Blot: MS4A7 Antibody [NBP2-87844] - WB Suggested Anti-MS4A7 Antibody. Titration: 1.0 ug/ml. Positive Control: Hela Whole Cell

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

MS4A7 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit MS4A7 Antibody - BSA Free (NBP2-87844) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of Human MS4A7. Peptide sequence: TGSLSIISGKQSTKPFDLSSLTSNAVSSVTAGAGLFLLADSMVALRTASQ The peptide sequence for this immunogen was taken from within the described region.
• Clonality: Polyclonal
• Host: Rabbit
• Gene: MS4A7
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for MS4A7 Antibody - BSA Free

• 4SPAN2
• CD20/FC-epsilon-RI-beta family member 4
• CD20L4
• CD20L4MGC22368
• CFFM4
• CFFM4CD20 antigen-like 4
• CFFMA
• Four-span transmembrane protein 2
• high affinity immunoglobulin epsilon receptor beta subunit
• membrane-spanning 4-domains subfamily A member 7
• membrane-spanning 4-domains, subfamily A, member 7,4SPAN2
• MS4A7
• MS4A8

Background

MS4A7 encodes a member of the membrane-spanning 4A gene family, members of which are characterized by common structural features and similar intron/exon splice boundaries and display unique expression patterns in hematopoietic cells and nonlymphoid tissues. This family member is associated with mature cellular function in the monocytic lineage, and it may be a component of a receptor complex involved in signal transduction. This gene is localized to 11q12, in a cluster of other family members. At least four alternatively spliced transcript variants encoding two distinct isoforms have been observed.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: MS4A7