MRTO4 Antibody

Images

 
Immunohistochemistry-Paraffin: MRTO4 Antibody [NBP1-88334] - Staining of human hippocampus shows distinct nucleolar positivity in neuronal cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

MRTO4 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:YKDNLHQVSKRLRGEVGLLFTNRTKEEVNEWFTKYTEMDYARAGNKAAFTVSLDPGPLEQFPHSMEPQLRQLGLPTALKRGVV
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (93%), Rat (93%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
MRTO4
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. IF fixation permeabilization: PFA/Triton X-100.
Control Peptide
MRTO4 Protein (NBP1-88334PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for MRTO4 Antibody

  • C1orf33
  • chromosome 1 open reading frame 33
  • dJ657E11.4
  • mRNA turnover 4 homolog (S. cerevisiae)
  • mRNA turnover protein 4 homolog
  • MRT4, mRNA turnover 4, homolog (S. cerevisiae)
  • MRT4, mRNA turnover 4, homolog
  • MRT460S acidic ribosomal protein PO

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-82859
Species: Hu
Applications: ICC/IF, IHC, IHC-P
H00011266-D01P
Species: Hu
Applications: WB, ELISA, ICC/IF
NB100-1607
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-20211
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-31336
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-30949
Species: Hu
Applications: IHC, IHC-P
NBP1-81293
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-15104
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF5866
Species: Hu
Applications: WB, IHC
NBP1-97512
Species: Mu
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP1-59448
Species: Hu
Applications: WB
NBP1-82853
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-32870
Species: Hu, Ch
Applications: WB, IHC, IHC-P, IP
NBP2-30693
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-57614
Species: Hu
Applications: ICC/IF
NBP1-47974
Species: Hu, Rt, Ca, Pm
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-49365
Species: Hu
Applications: ICC/IF, IHC
H00026156-B01P
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP1-78159
Species: Hu, Rt, Po, Bv
Applications: WB, EM, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, In vitro, RIA
NB100-56484
Species: Hu, Mu, Rt, Bv, Ca, Pm
Applications: WB

Publications for MRTO4 Antibody (NBP1-88334) (0)

There are no publications for MRTO4 Antibody (NBP1-88334).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MRTO4 Antibody (NBP1-88334) (0)

There are no reviews for MRTO4 Antibody (NBP1-88334). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for MRTO4 Antibody (NBP1-88334) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional MRTO4 Products

Bioinformatics Tool for MRTO4 Antibody (NBP1-88334)

Discover related pathways, diseases and genes to MRTO4 Antibody (NBP1-88334). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MRTO4 Antibody (NBP1-88334)

Discover more about diseases related to MRTO4 Antibody (NBP1-88334).

Research Areas for MRTO4 Antibody (NBP1-88334)

Find related products by research area.

Blogs on MRTO4

There are no specific blogs for MRTO4, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our MRTO4 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol MRTO4