MRPS30 Antibody - BSA Free

Western Blot: MRPS30 Antibody [NBP2-87837] - Host: Rabbit. Target Name: MRPS30. Sample Tissue: Human THP-1 Whole Cell lysates. Antibody Dilution: 1ug/ml

Product Discontinued

MRPS30 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit MRPS30 Antibody - BSA Free (NBP2-87837) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of human MRPS30. Peptide sequence: VTRPFVSQAVITDGKYFSFFCYQLNTLALTTQADQNNPRKNICWGTQSKP The peptide sequence for this immunogen was taken from within the described region.
• Clonality: Polyclonal
• Host: Rabbit
• Gene: MRPS30
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for MRPS30 Antibody - BSA Free

• 28S ribosomal protein S30, mitochondrial
• DKFZp566B2024
• mitochondrial ribosomal protein S30
• MRP-S30
• PAP
• PDCD9
• programmed cell death 9
• Programmed cell death protein 9
• S30mt

Background

MRPS30, or Mitochondrial Ribosomal Protein S30, consists of a 439 amino acid isoform that is 50 kDa, and is involved in mitochondrial protein synthesis in the heart, skeletal muscles, kidney, and liver. Current disease research is being conducted on MRPS30 and its relation to breast cancer, neuronitis, and prostatitis. MRPS30 has been linked to translation and apoptosis, through which it interacts with ICT1, MAGEA11, AARS2, AASS, and ABCB7.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: MRPS30