MRPS30 Antibody

Images

 
Western Blot: MRPS30 Antibody [NBP2-87837] - Host: Rabbit. Target Name: MRPS30. Sample Tissue: Human THP-1 Whole Cell lysates. Antibody Dilution: 1ug/ml

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

MRPS30 Antibody Summary

Immunogen
The immunogen is a synthetic peptide directed towards the C-terminal region of human MRPS30. Peptide sequence: VTRPFVSQAVITDGKYFSFFCYQLNTLALTTQADQNNPRKNICWGTQSKP The peptide sequence for this immunogen was taken from within the described region.
Clonality
Polyclonal
Host
Rabbit
Gene
MRPS30
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for MRPS30 Antibody

  • 28S ribosomal protein S30, mitochondrial
  • DKFZp566B2024
  • mitochondrial ribosomal protein S30
  • MRP-S30
  • PAP
  • PDCD9
  • programmed cell death 9
  • Programmed cell death protein 9
  • S30mt

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

DKK300
Species: Hu
Applications: ELISA
AF6240
Species: Hu
Applications: ELISA, IHC, WB
NBP2-13669
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-32920
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, KD, WB
AF4036
Species: Hu
Applications: Simple Western, WB
H00005324-M02
Species: Hu, Mu
Applications: ChIP, ELISA, IHC, IHC-P, WB
NBP2-93574
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
MAB25301
Species: Hu
Applications: CyTOF-ready, Flow, ICC, WB
NBP1-47974
Species: Ca, Hu, Pm, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NBP1-92172
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
H00005555-P01
Species: Hu
Applications: ELISA, AP, PA, PAGE, WB
NBP1-58268
Species: Hu, Mu
Applications: IHC, IHC-P, WB
NBP2-48990
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-79286
Species: Rt
Applications: WB
NBP2-43686
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
DSE100
Species: Hu
Applications: ELISA
NBP2-34594
Species: Hu, Pm
Applications: CyTOF-ready, Flow, ICC/IF, IHC, IHC-P
AF4478
Species: Hu
Applications: IHC, WB
H00005670-Q01
Species: Hu
Applications: ELISA, AP, PA, PAGE, WB

Publications for MRPS30 Antibody (NBP2-87837) (0)

There are no publications for MRPS30 Antibody (NBP2-87837).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MRPS30 Antibody (NBP2-87837) (0)

There are no reviews for MRPS30 Antibody (NBP2-87837). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for MRPS30 Antibody (NBP2-87837) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional MRPS30 Products

Bioinformatics Tool for MRPS30 Antibody (NBP2-87837)

Discover related pathways, diseases and genes to MRPS30 Antibody (NBP2-87837). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MRPS30 Antibody (NBP2-87837)

Discover more about diseases related to MRPS30 Antibody (NBP2-87837).
 

Pathways for MRPS30 Antibody (NBP2-87837)

View related products by pathway.

Research Areas for MRPS30 Antibody (NBP2-87837)

Find related products by research area.

Blogs on MRPS30

There are no specific blogs for MRPS30, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our MRPS30 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol MRPS30