MRPS18B Antibody

Western Blot: MRPS18B Antibody [H00028973-B02P] - Analysis of MRPS18B expression in transfected 293T cell line by MRPS18B polyclonal antibody. Lane 1: MRPS18B transfected lysate(28.38 KDa). Lane 2: Non-transfected lysate.

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Mouse
• Conjugate: Unconjugated

MRPS18B Antibody Summary

• Immunogen: MRPS18B (NP_054765.1, 1 a.a. - 258 a.a.) full-length human protein. MAASVLNTVLRRLPMLSLFRGSHRVQVPLQTLCTKAPSEEDSLSSVPISPYKDEPWKYLESEEYQERYGSRPVWADYRRNHKGGVPPQRTRKTCIRRNKVVGNPCPICRDHKLHVDFRNVKLLEQFVCAHTGIIFYAPYTGVCVKQHKRLTQAIQKARDHGLLIYHIPQVEPRDLDFSTSHGAVSATPPAPTLVSGDPWYPWYNWKQPPERELSRLRRLYQGHLQEESGPPPESMPKMPPRTPAEASSTGQTGPQSAL
• Specificity: MRPS18B - mitochondrial ribosomal protein S18B,
• Isotype: IgG
• Clonality: Polyclonal
• Host: Mouse
• Gene: MRPS18B
• Purity: Protein A purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1:500
• Application Notes: Antibody reactive against Recombinant Protein with GST tag on ELISA and Western Blot and also on transfected lysate in western blot. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.4)
• Preservative: No Preservative
• Purity: Protein A purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for MRPS18B Antibody

• 28S ribosomal protein S18-2, mitochondrial
• C6orf1428S ribosomal protein S18b, mitochondrial
• HSPC183
• HumanS18a
• mitochondrial ribosomal protein S18-2
• mitochondrial ribosomal protein S18B
• MRP-S18-2
• MRPS18-2DKFZp564H0223
• MRP-S18-b
• mrps18-b
• PTD017
• S18amt
• S18mt-b

Background

Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. They have an estimated 75% protein to rRNA composition compared to prokaryotic ribosomes, where this ratio is reversed. Another difference between mammalian mitoribosomes and prokaryotic ribosomes is that the latter contain a 5S rRNA. Among different species, the proteins comprising the mitoribosome differ greatly in sequence, and sometimes in biochemical properties, which prevents easy recognition by sequence homology. This gene encodes a 28S subunit protein that belongs to the ribosomal protein S18P family. The encoded protein is one of three that has significant sequence similarity to bacterial S18 proteins. The primary sequences of the three human mitochondrial S18 proteins are no more closely related to each other than they are to the prokaryotic S18 proteins. Pseudogenes corresponding to this gene are found on chromosomes 1q and 2q. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: MRPS18B
• Entrez:
  • 28973(Human)
• Uniprot:
  • NP_054765.1(Human)