Recombinant Human MRPL51 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human MRPL51 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-128 of Human MRPL51 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MAGNLLSGAGRRLWDWVPLACRSFSLGVPRLIGIRLTLPPPKVVDRWNEKRAMFGVYDNIGILGNFEKHPKELIRGPIWLRGWKGNELQRCIRKRKMVGSRMFADDLHNLNKRIRYLYKHFNRHGKFR

Protein/Peptide Type
Recombinant Protein
Gene
MRPL51

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human MRPL51 Protein

  • bMRP64bMRP-64
  • HSPC241,39S ribosomal protein L51, mitochondrial
  • L51mt
  • mitochondrial ribosomal protein 64
  • mitochondrial ribosomal protein bMRP64
  • mitochondrial ribosomal protein L51
  • MRP64CDA09
  • MRP-L51

Background

MRPL51( AAH00191, 1 a.a. - 129 a.a.) recombinant protein with GST.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-34951
Species: Hu
NBP1-40256
Species: Hu, Mu, Rt, Fi, Ha, Rb
Applications: WB, ChIP, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready
NB100-80861
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-1471
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, PEP-ELISA
NB100-63269
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IP
H00005018-D01P
Species: Hu
Applications: WB, ICC/IF
NBP1-87847
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-84725
Species: Hu
Applications: WB, IHC, IHC-P
AF1120
Species: Mu
Applications: WB, IHC
NBP1-83882
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-13618
Species: Hu
Applications: IHC, IHC-P
NB100-1919
Species: Hu, Mu, Rt, Ca, Fe
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-82786
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-45897
Species: Hu
Applications: WB, IHC
NBP2-30482
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00065008-M02
Species: Hu
Applications: WB, ELISA, ICC/IF
AF7895
Species: Hu
Applications: WB, IHC
AF1334
Species: Hu
Applications: WB, IHC
H00051258-P01
Species: Hu
Applications: WB, ELISA, PA

Publications for MRPL51 Recombinant Protein (H00051258-P01) (0)

There are no publications for MRPL51 Recombinant Protein (H00051258-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MRPL51 Recombinant Protein (H00051258-P01) (0)

There are no reviews for MRPL51 Recombinant Protein (H00051258-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for MRPL51 Recombinant Protein (H00051258-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional MRPL51 Products

Bioinformatics Tool for MRPL51 Recombinant Protein (H00051258-P01)

Discover related pathways, diseases and genes to MRPL51 Recombinant Protein (H00051258-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MRPL51 Recombinant Protein (H00051258-P01)

Discover more about diseases related to MRPL51 Recombinant Protein (H00051258-P01).
 

Pathways for MRPL51 Recombinant Protein (H00051258-P01)

View related products by pathway.

Blogs on MRPL51

There are no specific blogs for MRPL51, but you can read our latest blog posts.

Customers Who Bought This Also Bought

MRPL51 Antibody
NBP1-88567
ATF6 Antibody (70B1413.1)
NBP1-40256-0.1mg

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human MRPL51 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol MRPL51