MRPL49 Antibody - BSA Free

Western Blot: MRPL49 Antibody [NBP1-68932] - Jurkat cell lysate, concentration 0.2-1 ug/ml.

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

MRPL49 Antibody - BSA Free Summary

• Description: The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
• Immunogen: Synthetic peptides corresponding to MRPL49 (mitochondrial ribosomal protein L49) The peptide sequence was selected from the N terminal of MRPL49. Peptide sequence ESVDEYQFVERLLPATRIPDPPKHEHYPTPSGWQPPRDPPPNLPYFVRRS. The peptide sequence for this immunogen was taken from within the described region.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: MRPL49
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml
• Theoretical MW: 19 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for MRPL49 Antibody - BSA Free

• C11orf4
• L49mt39S ribosomal protein L49, mitochondrial
• mitochondrial ribosomal protein L49
• MRP-L49
• Neighbor of FAU
• next to FAU
• NOF1chromosome 11 open reading frame 4
• NOFMGC10656
• Protein NOF1

Background

Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. They have an estimated 75% protein to rRNA composition compared to prokaryotic ribosomes, where this ratio is reversed. Another difference between mammalian mitoribosomes and prokaryotic ribosomes is that the latter contain a 5S rRNA. Among different species, the proteins comprising the mitoribosome differ greatly in sequence, and sometimes in biochemical properties, which prevents easy recognition by sequence homology. This gene encodes a 39S subunit protein. This gene and the gene for the HRD1 protein use in their respective 3' UTRs some of the same genomic sequence. Pseudogenes corresponding to this gene are found on chromosomes 5q and 8p.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: MRPL49
• Uniprot:
  • Q13405(Human)