MRPL49 Antibody


Western Blot: MRPL49 Antibody [NBP1-68932] - Jurkat cell lysate, concentration 0.2-1 ug/ml.

Product Details

Reactivity HuSpecies Glossary
Applications WB

Order Details

MRPL49 Antibody Summary

Synthetic peptides corresponding to MRPL49 (mitochondrial ribosomal protein L49) The peptide sequence was selected from the N terminal of MRPL49. Peptide sequence ESVDEYQFVERLLPATRIPDPPKHEHYPTPSGWQPPRDPPPNLPYFVRRS.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against MRPL49 and was validated on Western blot.
Theoretical MW
19 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS and 2% Sucrose
0.09% Sodium Azide
Immunogen affinity purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for MRPL49 Antibody

  • C11orf4
  • L49mt39S ribosomal protein L49, mitochondrial
  • mitochondrial ribosomal protein L49
  • MRP-L49
  • Neighbor of FAU
  • next to FAU
  • NOF1chromosome 11 open reading frame 4
  • NOFMGC10656
  • Protein NOF1


Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. They have an estimated 75% protein to rRNA composition compared to prokaryotic ribosomes, where this ratio is reversed. Another difference between mammalian mitoribosomes and prokaryotic ribosomes is that the latter contain a 5S rRNA. Among different species, the proteins comprising the mitoribosome differ greatly in sequence, and sometimes in biochemical properties, which prevents easy recognition by sequence homology. This gene encodes a 39S subunit protein. This gene and the gene for the HRD1 protein use in their respective 3' UTRs some of the same genomic sequence. Pseudogenes corresponding to this gene are found on chromosomes 5q and 8p.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB, Simple Western, IHC, ICC
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt, Bv
Applications: WB, IA, IHC, IHC-Fr, IHC-P, IP
Species: Hu
Applications: WB, ELISA, Flow, IHC, IHC-P
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu
Species: Hu
Applications: IHC, IHC-P
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu
Applications: WB, Simple Western, IHC, IHC-P
Species: Hu
Applications: WB, CyTOF-ready, ICC, ICFlow
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ELISA, ICC/IF
Species: Hu
Applications: WB

Publications for MRPL49 Antibody (NBP1-68932) (0)

There are no publications for MRPL49 Antibody (NBP1-68932).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MRPL49 Antibody (NBP1-68932) (0)

There are no reviews for MRPL49 Antibody (NBP1-68932). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for MRPL49 Antibody (NBP1-68932) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional MRPL49 Products

Bioinformatics Tool for MRPL49 Antibody (NBP1-68932)

Discover related pathways, diseases and genes to MRPL49 Antibody (NBP1-68932). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MRPL49 Antibody (NBP1-68932)

Discover more about diseases related to MRPL49 Antibody (NBP1-68932).

Pathways for MRPL49 Antibody (NBP1-68932)

View related products by pathway.

Research Areas for MRPL49 Antibody (NBP1-68932)

Find related products by research area.

Blogs on MRPL49

There are no specific blogs for MRPL49, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our MRPL49 Antibody and receive a gift card or discount.


Gene Symbol MRPL49