MRPL48 Antibody

Images

 
Immunohistochemistry-Paraffin: MRPL48 Antibody [NBP2-30586] - Staining of human duodenum shows moderate cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

MRPL48 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: IKVEESYAMPTKTIEVLQLQDQGSKMLLDSVLTTHERVVQISGLSATFAEIFLEIIQSSLPEGVRLSVKEHTEEDFKGRFKARPELEELL
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
MRPL48
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
MRPL48 Protein (NBP2-30586PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (88%), Rat (89%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for MRPL48 Antibody

  • 39S ribosomal protein L48, mitochondrial
  • CGI-118
  • FLJ17047
  • FLJ99260
  • HSPC290
  • L48MT
  • MGC13323
  • mitochondrial ribosomal protein L48
  • MRP-L48

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-33061
Species: Hu, Mu, Rt
Applications: WB, IB, ICC/IF, IHC, IHC-P, IP
AF5724
Species: Hu, Mu, Rt
Applications: WB, ICC
NBP2-14892
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-57265
Species: Hu
Applications: WB, ICC/IF
NBP1-85620
Species: Hu
Applications: ICC/IF, IHC, IHC-P
H00005018-D01P
Species: Hu
Applications: WB, ICC/IF
NBP1-88567
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-87847
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-57476
Species: Hu
Applications: WB, ICC/IF, IHC
NBP1-28489
Species: Rt
Applications: WB, PEP-ELISA
NBP1-81212
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-13618
Species: Hu
Applications: IHC, IHC-P
NB300-221
Species: Hu, Mu, Rt, Po, Av, Bv, Ch, Eq, Ha, Op, Pm, Sh, Ze
Applications: WB, Simple Western, ChIP, ICC/IF, IHC, IP
NBP1-06069
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
NB100-1919
Species: Hu, Mu, Rt, Ca, Fe
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-32572
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-33622
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-49581
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-13254
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-30586
Species: Hu
Applications: IHC, IHC-P

Publications for MRPL48 Antibody (NBP2-30586) (0)

There are no publications for MRPL48 Antibody (NBP2-30586).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MRPL48 Antibody (NBP2-30586) (0)

There are no reviews for MRPL48 Antibody (NBP2-30586). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for MRPL48 Antibody (NBP2-30586) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional MRPL48 Products

Bioinformatics Tool for MRPL48 Antibody (NBP2-30586)

Discover related pathways, diseases and genes to MRPL48 Antibody (NBP2-30586). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MRPL48 Antibody (NBP2-30586)

Discover more about diseases related to MRPL48 Antibody (NBP2-30586).
 

Pathways for MRPL48 Antibody (NBP2-30586)

View related products by pathway.

Blogs on MRPL48

There are no specific blogs for MRPL48, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our MRPL48 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol MRPL48
Uniprot