RPL28 Antibody

Images

 
Western Blot: RPL28 Antibody [NBP2-13254] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
Immunocytochemistry/ Immunofluorescence: RPL28 Antibody [NBP2-13254] - Immunofluorescent staining of human cell line MCF7 shows localization to cytosol & endoplasmic reticulum.
Immunohistochemistry-Paraffin: RPL28 Antibody [NBP2-13254] - Staining of human pancreas shows strong cytoplasmic positivity in exocrine glandular cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

RPL28 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: QRKPATSYVRTTINKNARATLSSIRHMIRKNKYRPDLRMAAIRRASAILR SQKPVMVKRKRT
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (98%), Rat (98%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
RPL28
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:500 - 1:1000
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:500-1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. For Immunofluorescence, Fixation/Permeabilization: PFA/Triton X-100.
Control Peptide
RPL28 Protein (NBP2-13254PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for RPL28 Antibody

  • FLJ43307,60S ribosomal protein L28
  • ribosomal protein L28

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-49581
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-88446
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-20210
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-82856
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-20216
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-58707
Species: Hu
Applications: WB, ICC/IF
NBP1-76549
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
H00009768-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-06930
Species: Hu
NBP2-20211
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-13251
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-31413
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-30682
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-2269
Species: Hu, Mu
Applications: WB, IHC-P, IP
NBP1-88582
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00026156-B01P
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP2-20212
Species: Hu
Applications: WB, IHC, IHC-P
H00028299-P01
Species: Hu
H00029956-M01A
Species: Hu, Mu
Applications: WB, ELISA, IHC-P
NBP2-20214
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for RPL28 Antibody (NBP2-13254) (0)

There are no publications for RPL28 Antibody (NBP2-13254).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RPL28 Antibody (NBP2-13254) (0)

There are no reviews for RPL28 Antibody (NBP2-13254). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for RPL28 Antibody (NBP2-13254) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional RPL28 Products

Bioinformatics Tool for RPL28 Antibody (NBP2-13254)

Discover related pathways, diseases and genes to RPL28 Antibody (NBP2-13254). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RPL28 Antibody (NBP2-13254)

Discover more about diseases related to RPL28 Antibody (NBP2-13254).
 

Pathways for RPL28 Antibody (NBP2-13254)

View related products by pathway.

PTMs for RPL28 Antibody (NBP2-13254)

Learn more about PTMs related to RPL28 Antibody (NBP2-13254).

Blogs on RPL28

There are no specific blogs for RPL28, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our RPL28 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol RPL28