MRPL41 Antibody - BSA Free

Western Blot: MRPL41 Antibody [NBP2-87826] - WB Suggested Anti-MRPL41 Antibody. Titration: 1.0 ug/ml. Positive Control: 293T Whole CellMRPL41 is supported by BioGPS gene expression data to be expressed in HEK293T

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

MRPL41 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit MRPL41 Antibody - BSA Free (NBP2-87826) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human MRPL41. Peptide sequence: ESEETPLTAAQLFSEAVAPAIEKDFKDGTFDPDNLEKYGFEPTQEGKLFQ The peptide sequence for this immunogen was taken from within the described region.
• Clonality: Polyclonal
• Host: Rabbit
• Gene: MRPL41
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for MRPL41 Antibody - BSA Free

• Bcl-2-interacting mitochondrial ribosomal protein L41,39S ribosomal protein L41, mitochondrial
• BMRPMRP-L41
• Cell proliferation-inducing gene 3 protein
• mitochondrial ribosomal protein L41,39S ribosomal protein L27 homolog
• MRP-L27
• MRPL27L41mt
• PIG3
• proliferation-inducing gene 3
• RPML27MRP-L27 homolog

Background

MRPL41, also known as 39 S ribosomal protein L41, mitochondrial, is a 15.4 kDa, 137 amino acid protein that is involved in the cell cycle and apoptosis as a component of the large subunit of ribosomes in the mitochondria. Current research is investigating the effect of the protein on diseases such as breast cancer and duodenogastric reflux. The protein interacts with SMURF2, C20orf24, ICT1, SLX4, and TRIM63 proteins in cell cycle pathways.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: MRPL41