MRPL38 Antibody

Images

 
Independent Antibodies: Western Blot: MRPL38 Antibody [NBP1-81673] - Analysis using Anti-MRPL38 antibody NBP1-81673 (A) shows similar pattern to independent antibody NBP1-81672 (B).
Immunohistochemistry: MRPL38 Antibody [NBP1-81673] - Staining of human gallbladder shows moderate cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
 

Independent Antibodies

       

Order Details

MRPL38 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: FHGATFVPRVPLHVAYAVGEDDLMPVYCGNEVTPTEAAQAPEVTYEAEEGSLWTLLLTSLDGHLLEPDAEYLHWLLTNIPGNRVAE
Specificity
Specificity of human MRPL38 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
MRPL38
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.04-0.4 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
MRPL38 Protein (NBP1-81673PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (84%), Rat (84%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for MRPL38 Antibody

  • FLJ13996
  • HSPC262
  • KIAA1863
  • L38MT
  • MGC4810
  • mitochondrial ribosomal protein L38,39S ribosomal protein L38, mitochondrial
  • MRP-L3
  • MRP-L38
  • RPML3

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-30693
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-89814
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, KD
NBP1-89715
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-47659
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-78159
Species: Hu, Rt, Po, Bv
Applications: WB, EM, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, In vitro, PLA, RIA
H00002038-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP1-90649
Species: Hu
Applications: IHC, IHC-P
H00091107-M02
Species: Hu
Applications: WB, ELISA, ICC/IF
AF6278
Species: Hu, Mu
Applications: WB
NBP1-58359
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-25159
Species: Hu, Mu, Rt, Po, Bv, Eq
Applications: WB, ICC/IF, IHC
AF1927
Species: Hu
Applications: WB, IP, ICC
H00006944-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP2-75519
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-88334
Species: Hu
Applications: IHC, IHC-P
NBP2-15514
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-01763
Species: Hu, Mu
Applications: WB, Flow, IHC, IHC-P
NBP1-81673
Species: Hu
Applications: WB, IHC, IHC-P

Publications for MRPL38 Antibody (NBP1-81673) (0)

There are no publications for MRPL38 Antibody (NBP1-81673).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MRPL38 Antibody (NBP1-81673) (0)

There are no reviews for MRPL38 Antibody (NBP1-81673). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for MRPL38 Antibody (NBP1-81673) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional MRPL38 Products

Bioinformatics Tool for MRPL38 Antibody (NBP1-81673)

Discover related pathways, diseases and genes to MRPL38 Antibody (NBP1-81673). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MRPL38 Antibody (NBP1-81673)

Discover more about diseases related to MRPL38 Antibody (NBP1-81673).
 

Pathways for MRPL38 Antibody (NBP1-81673)

View related products by pathway.

Blogs on MRPL38

There are no specific blogs for MRPL38, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our MRPL38 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol MRPL38