MRPL38 Antibody - BSA Free

Western Blot: MRPL38 Antibody [NBP1-81672] - Analysis using Anti-MRPL38 antibody NBP1-81672 (A) shows similar pattern to independent antibody NBP1-81673 (B).

Immunocytochemistry/Immunofluorescence: MRPL38 Antibody [NBP1-81672] - Immunofluorescent staining of human cell line U-251 MG shows localization to mitochondria.

Immunohistochemistry: MRPL38 Antibody [NBP1-81672] - Staining of human gallbladder shows strong cytoplasmic positivity in glandular cells.

• Reactivity: Hu
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

MRPL38 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit MRPL38 Antibody - BSA Free (NBP1-81672) is a polyclonal antibody validated for use in IHC, WB and ICC/IF. Anti-MRPL38 Antibody: Cited in 1 publication. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: EYFGEKTDPKEKIDIGLPPPKVSRTQQLLERKQAIQELRANVEEERAARLRTASVPLDAVRAEWERTCGPYHKQRL
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: MRPL38
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  MRPL38 Protein (NBP1-81672PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (83%), Rat (80%). Reactivity reported in scientific literature (PMID: 25866880)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for MRPL38 Antibody - BSA Free

• FLJ13996
• HSPC262
• KIAA1863
• L38MT
• MGC4810
• mitochondrial ribosomal protein L38,39S ribosomal protein L38, mitochondrial
• MRP-L3
• MRP-L38
• RPML3

Background

Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. They have an estimated 75% protein to rRNA composition compared to prokaryotic ribosomes, where this ratio is reversed. Another difference between mammalian mitoribosomes and prokaryotic ribosomes is that the latter contain a 5S rRNA. Among different species, the proteins comprising the mitoribosome differ greatly in sequence, and sometimes in biochemical properties, which prevents easy recognition by sequence homology. This gene encodes a 39S subunit protein. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for MRPL38 Antibody (NBP1-81672)(1)

Publication using NBP1-81672

• Zhang X, Gao X, Coots RA et al. Translational control of the cytosolic stress response by mitochondrial ribosomal protein L18. Nat Struct Mol Biol 2015-05-01 [PMID: 25866880]

Bioinformatics

• Gene Symbol: MRPL38