MRPL19 Antibody

Images

 
Western Blot: MRPL19 Antibody [H00009801-B01P] - Analysis of MRPL19 expression in transfected 293T cell line by MRPL19 polyclonal antibody. Lane 1: MRPL19 transfected lysate(32.23 KDa). Lane 2: Non-transfected lysate.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, Flow, KD
Clonality
Polyclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

MRPL19 Antibody Summary

Immunogen
MRPL19 (AAH30144, 1 a.a. - 292 a.a.) full-length human protein. MAACIAAGHWAAMGLGRSFQAARTLLPPPASIACRVHAGPVRQQSTGPSEPGAFQPPPKPVIVDKHRPVEPERRFLSPEFIPRRGRTDPLKFQIERKDMLERRKVLHIPEFYVGSILRVTTADPYASGKISQFLGICIQRSGRGLGATFILRNVIEGQGVEICFELYNPRVQEIQVVKLEKRLDDSLLYLRDALPEYSTFDVNMKPVVQEPNQKVPVNELRVKMKPKPWSKRWERPNFNIKGIRFDLCLTEQQMKEAQKWNQPWLEFDMMREYDTSKIEAAIWKEIEASKRS
Specificity
MRPL19 - mitochondrial ribosomal protein L19,
Isotype
IgG
Clonality
Polyclonal
Host
Mouse
Gene
MRPL19
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:500
  • Flow Cytometry
  • Knockdown Validated
Application Notes
Antibody reactive against Recombinant Protein with GST tag on ELISA and Western Blot and also on transfected lysate in western blot. GST tag alone is used as a negative control. Use in KD reported in secitific publication PMID: 32618081
Publications
Read Publication using
H00009801-B01P in the following applications:

  • 1 publication
  • KD
    1 publication
  • WB
    1 publication

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein A purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for MRPL19 Antibody

  • KIAA0104L19mt
  • L15mt
  • MGC20675
  • mitochondrial ribosomal protein L19
  • mitochondrial
  • MRPL1539S ribosomal protein L19, mitochondrial
  • MRP-L15MRP-L19
  • RLX1
  • RPML15

Background

Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. They have an estimated 75% protein to rRNA composition compared to prokaryotic ribosomes, where this ratio is reversed. Another difference between mammalian mitoribosomes and prokaryotic ribosomes is that the latter contain a 5S rRNA. Among different species, the proteins comprising the mitoribosome differ greatly in sequence, and sometimes in biochemical properties, which prevents easy recognition by sequence homology. This gene encodes a 39S subunit protein. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB300-221
Species: Hu, Mu, Rt, Po, Av, Bv, Ca, Ch, ChHa, Dr, Eq, Fe, Ha, Ma-Op, Pm, Rb, Sh, Ze
Applications: WB, Simple Western, ChIP, ICC/IF, IHC, IHC-Fr, IP, KD, Single-Cell Western
NBP1-68766
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P, PEP-ELISA
H00006936-B01P
Species: Hu
Applications: WB, ICC/IF
NBP3-07477
Species: Hu
Applications: WB, Flow, ICC/IF, PA
NBP1-84298
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NB600-501
Species: Hu, Mu, Rt, Po, Bv, Ca, Ch, Fe, Fi, Gp, Ha, Le, Ma, Pm, Rb, Sh, Sq, Ze, Dr(-)
Applications: WB, Simple Western, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, ChIP, KD, KO
NB500-317
Species: Hu, Bv(-), Ca(-), Ch(-), Mu(-), Rb(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, IP, RIA
NB600-533
Species: Hu, Mu
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IP
AF3589
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC
NBP1-33527
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF1749
Species: Rt
Applications: WB, IHC
NBP1-82859
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-259
Species: Hu, Mu
Applications: WB, GS, ICC/IF, IP
NBP1-87799
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-87511
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-41187
Species: Hu
Applications: WB, ELISA, IF
NBP2-59208
Species: Hu, Mu
Applications: WB, ChIP, CHIP-SEQ, KD
NBP2-19784
Species: Hu, Mu, Rt, Ye
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, PLA
NBP1-57578
Species: Hu
Applications: WB
NBP2-56410
Species: Hu
Applications: WB, IHC, IHC-P, KD

Publications for MRPL19 Antibody (H00009801-B01P)(1)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 3 applications: Flow, KD, WB.


Filter By Application
Flow
(1)
KD
(1)
WB
(1)
All Applications
Filter By Species
Human
(1)
All Species

Reviews for MRPL19 Antibody (H00009801-B01P) (0)

There are no reviews for MRPL19 Antibody (H00009801-B01P). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for MRPL19 Antibody (H00009801-B01P) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional MRPL19 Products

Bioinformatics Tool for MRPL19 Antibody (H00009801-B01P)

Discover related pathways, diseases and genes to MRPL19 Antibody (H00009801-B01P). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MRPL19 Antibody (H00009801-B01P)

Discover more about diseases related to MRPL19 Antibody (H00009801-B01P).
 

Pathways for MRPL19 Antibody (H00009801-B01P)

View related products by pathway.

Blogs on MRPL19

There are no specific blogs for MRPL19, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our MRPL19 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol MRPL19
Entrez
Uniprot