MRPL19 Antibody - Azide and BSA Free

Western Blot: MRPL19 Antibody [H00009801-B01P] - Analysis of MRPL19 expression in transfected 293T cell line by MRPL19 polyclonal antibody. Lane 1: MRPL19 transfected lysate(32.23 KDa). Lane 2: Non-transfected lysate.

• Reactivity: Hu
• Applications: WB, Flow, Mycoplasma
• Clonality: Polyclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

MRPL19 Antibody - Azide and BSA Free Summary

• Description: Novus Biologicals Mouse MRPL19 Antibody - Azide and BSA Free (H00009801-B01P) is a polyclonal antibody validated for use in WB and Flow. Anti-MRPL19 Antibody: Cited in 1 publication. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: MRPL19 (AAH30144, 1 a.a. - 292 a.a.) full-length human protein. MAACIAAGHWAAMGLGRSFQAARTLLPPPASIACRVHAGPVRQQSTGPSEPGAFQPPPKPVIVDKHRPVEPERRFLSPEFIPRRGRTDPLKFQIERKDMLERRKVLHIPEFYVGSILRVTTADPYASGKISQFLGICIQRSGRGLGATFILRNVIEGQGVEICFELYNPRVQEIQVVKLEKRLDDSLLYLRDALPEYSTFDVNMKPVVQEPNQKVPVNELRVKMKPKPWSKRWERPNFNIKGIRFDLCLTEQQMKEAQKWNQPWLEFDMMREYDTSKIEAAIWKEIEASKRS
• Specificity: MRPL19 - mitochondrial ribosomal protein L19,
• Isotype: IgG
• Clonality: Polyclonal
• Host: Mouse
• Gene: MRPL19
• Purity: Protein A purified

Applications/Dilutions

• Dilutions:
  • Flow Cytometry
  • Knockdown Validated
  • Western Blot 1:500
• Application Notes: Antibody reactive against Recombinant Protein with GST tag on ELISA and Western Blot and also on transfected lysate in western blot. GST tag alone is used as a negative control. Use in KD reported in secitific publication PMID: 32618081

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.4)
• Preservative: No Preservative
• Purity: Protein A purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for MRPL19 Antibody - Azide and BSA Free

• KIAA0104L19mt
• L15mt
• MGC20675
• mitochondrial ribosomal protein L19
• mitochondrial
• MRPL1539S ribosomal protein L19, mitochondrial
• MRP-L15MRP-L19
• RLX1
• RPML15

Background

Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. They have an estimated 75% protein to rRNA composition compared to prokaryotic ribosomes, where this ratio is reversed. Another difference between mammalian mitoribosomes and prokaryotic ribosomes is that the latter contain a 5S rRNA. Among different species, the proteins comprising the mitoribosome differ greatly in sequence, and sometimes in biochemical properties, which prevents easy recognition by sequence homology. This gene encodes a 39S subunit protein. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for MRPL19 Antibody (H00009801-B01P)(1)

Publication using H00009801-B01P

• Guan X, Zhang H, Qin H et al. CRISPR/Cas9-mediated whole genomic wide knockout screening identifies mitochondrial ribosomal proteins involving in oxygen-glucose deprivation/reperfusion resistance J. Cell. Mol. Med. 2020-07-02 [PMID: 32618081] (FLOW, WB, KD, Human)

Bioinformatics

• Gene Symbol: MRPL19
• Entrez:
  • 9801(Human)
• Uniprot:
  • AAH30144(Human)