MRPL12 Antibody - BSA Free

Western Blot: MRPL12 Antibody [NBP1-85216] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA depleted). Lane 5: Human liver tissue. Lane 6: Human tonsil tissue

Immunocytochemistry/Immunofluorescence: MRPL12 Antibody [NBP1-85216] - Immunofluorescent staining of human cell line U-251 MG shows localization to mitochondria.

Immunohistochemistry-Paraffin: MRPL12 Antibody [NBP1-85216] - Staining of human colon shows strong cytoplasmic positivity with a granular pattern in glandular cells.

• Reactivity: Hu
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

MRPL12 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit MRPL12 Antibody - BSA Free (NBP1-85216) is a polyclonal antibody validated for use in IHC, WB and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: VMSGAVPAAAAQEAVEEDIPIAKERTHFTVRLTEAKPVDKVKLIKEIKNYIQGINLVQAKKLVESLPQEIKANVAKAEAEKIKAALEAVGGTVVLE
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: MRPL12
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  MRPL12 Recombinant Protein Antigen (NBP1-85216PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (86%), Rat (86%)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for MRPL12 Antibody - BSA Free

• 5c5-2
• FLJ60124
• L12mt
• MGC8610
• mitochondrial ribosomal protein L12
• MRP-L12
• MRP-L31/34
• MRPL7
• MRPL7/L12
• RPML1239S ribosomal protein L12, mitochondrial

Background

MRPL12, also known as 39 S ribosomal protein L12, mitochondrial, is a 21.3 kDa, 198 amino acid protein that is involved in mitochondrial protein synthesis by forming homodimers in 39S subunits. Current research is being conducted to identify the effect of the protein on diseases such as prostate cancer and prostatitis. The protein interacts in translation pathways with other proteins such as ICT1, MRPL3, SRRM2, PPP2R2B, and TMEM51.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: MRPL12