Recombinant Human MRP1 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human MRP1 Protein Summary

Description
Recombinant protein with GST-tag at N-terminal corresponding to the amino acids 816 - 915 of Human ABCC1 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MLKNKTRILVTHSMSYLPQVDVIIVMSGGKISEMGSYQELLARDGAFAEFLRTYASTEQEQDAEENGVTGVSGPGKEAKQMENGMLVTDSAGKQLQRQLS

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
ABCC1
Purity
>80%, by SDS-PAGE

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Purity
>80%, by SDS-PAGE

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human MRP1 Protein

  • ABC29
  • ABCC
  • ABCC1
  • ATP-binding cassette sub-family C member 1
  • ATP-binding cassette, sub-family C (CFTR/MRP), member 1
  • EC 3.6.3
  • EC 3.6.3.44
  • GS-X
  • Leukotriene C(4) transporter
  • LTC4 transporter
  • MRP1
  • MRP1DKFZp781G125
  • MRPDKFZp686N04233
  • multidrug resistance associated protein 1
  • multidrug resistance protein
  • multidrug resistance-associated protein 1
  • multiple drug resistance protein 1
  • multiple drug resistance-associated protein

Background

ABCC1 - ATP-binding cassette, sub-family C (CFTR/MRP), member 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-46466
Species: Hu
Applications: IHC
NBP1-42349
Species: Hu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-22124
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP2-13415
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-76670
Species: Hu, Rt
Applications: WB, ELISA, IHC, IHC-P
NBP2-37923
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-33560
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-91642
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-1471
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, PEP-ELISA
AF6278
Species: Hu, Mu
Applications: WB
NB100-94881
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
NBP2-52506
Species: Hu
Applications: WB, ELISA, Flow, IHC, CyTOF-ready, ICC, IF
NLS6792
Species: Hu, Mu, Po, Bt, Bv, Ca, Eq, Ha, Mk, Pm, Rb
Applications: IHC-P
NBP1-33002
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-19417
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
MAB25031
Species: Hu
Applications: WB, IHC, IP
NBP1-42342
Species: Hu
Applications: WB, Flow, IHC, IHC-Fr
NB100-56098
Species: Hu, Mu, Ca
Applications: WB, IHC, IHC-P, IP

Publications for MRP1 Partial Recombinant Protein (H00004363-Q01) (0)

There are no publications for MRP1 Partial Recombinant Protein (H00004363-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MRP1 Partial Recombinant Protein (H00004363-Q01) (0)

There are no reviews for MRP1 Partial Recombinant Protein (H00004363-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for MRP1 Partial Recombinant Protein (H00004363-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional MRP1 Products

MRP1 H00004363-Q01

Bioinformatics Tool for MRP1 Partial Recombinant Protein (H00004363-Q01)

Discover related pathways, diseases and genes to MRP1 Partial Recombinant Protein (H00004363-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MRP1 Partial Recombinant Protein (H00004363-Q01)

Discover more about diseases related to MRP1 Partial Recombinant Protein (H00004363-Q01).
 

Pathways for MRP1 Partial Recombinant Protein (H00004363-Q01)

View related products by pathway.

PTMs for MRP1 Partial Recombinant Protein (H00004363-Q01)

Learn more about PTMs related to MRP1 Partial Recombinant Protein (H00004363-Q01).
 

Research Areas for MRP1 Partial Recombinant Protein (H00004363-Q01)

Find related products by research area.

Blogs on MRP1.

ABC Membrane transporters and the role of MRP1 in drug resistance
ATP-binding cassette (ABC) transporters, alongside ion channels and aquaporins, are ubiquitous membrane-bound proteins that move substrates across extra and intra cellular membranes.  Multidrug resistance-associated protein 1 (MRP1) is a member o...  Read full blog post.

Customers Who Bought This Also Bought

MRP1 Antibody (IU2H10)
NB400-156-0.1ml
Bcl-2 Antibody
NB100-56098

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human MRP1 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol ABCC1
Entrez