MPZL1 Antibody

Images

 
Western Blot: MPZL1 Antibody [H00009019-B01P] - Analysis of MPZL1 expression in transfected 293T cell line by MPZL1 polyclonal antibody. Lane 1: MPZL1 transfected lysate(29.59 KDa). Lane 2: Non-transfected lysate.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

MPZL1 Antibody Summary

Immunogen
MPZL1 (NP_003944.1, 1 a.a. - 269 a.a.) full-length human protein. MAASAGAGAVIAAPDSRRWLWSVLAAALGLLTAGVSALEVYTPKEIFVANGTQGKLTCKFKSTSTTGGLTSVSWSFQPEGADTTVSFFHYSQGQVYLGNYPPFKDRISWAGDLDKKDASINIENMQFIHNGTYICDVKNPPDIVVQPGHIRLYVVEKENLPVFPVWVVVGIVTAVVLGLTLLISMILAVLYRRKNSKRDYTGCSTSESLSPVKQAPRKSPSDTEGLVKSLPSGSHQGPVIYAQLDHSGGHHSDKINKSESVVYADIRKN
Specificity
MPZL1 - myelin protein zero-like 1,
Isotype
IgG
Clonality
Polyclonal
Host
Mouse
Gene
MPZL1
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB and also on transfected lysate in WB. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein A purified

Notes

Quality control test: Antibody reactive against mammalian transfected lysate.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for MPZL1 Antibody

  • FLJ21047
  • immunoglobulin family transmembrane protein
  • MPZL1b
  • myelin protein zero-like 1
  • myelin protein zero-like protein 1
  • protein zero related
  • Protein zero-related
  • PZR1b
  • PZRb
  • PZRPZRa

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF2685
Species: Hu
Applications: WB, Simple Western, IHC
NBP2-54602
Species: Vi
Applications: WB, ELISA, Flow, ICC/IF
NB100-1607
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-83276
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
MAB7307
Species: Rt
Applications: WB, Flow, CyTOF-ready, Neut
NBP1-91258
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP2-25250
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P
NB600-1071
Species: Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NB120-16518
Species: Hu, Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
AF467
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP2-53384
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC-P
NBP1-82859
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-32972
Species: Hu, Mu, Rt, Ch, Pm, Sh
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NB110-59723
Species: Hu, Mu, Po
Applications: WB, ICC/IF, IF
H00006329-R01
Species: Hu

Publications for MPZL1 Antibody (H00009019-B01P) (0)

There are no publications for MPZL1 Antibody (H00009019-B01P).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MPZL1 Antibody (H00009019-B01P) (0)

There are no reviews for MPZL1 Antibody (H00009019-B01P). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for MPZL1 Antibody (H00009019-B01P) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional MPZL1 Products

Bioinformatics Tool for MPZL1 Antibody (H00009019-B01P)

Discover related pathways, diseases and genes to MPZL1 Antibody (H00009019-B01P). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MPZL1 Antibody (H00009019-B01P)

Discover more about diseases related to MPZL1 Antibody (H00009019-B01P).
 

Pathways for MPZL1 Antibody (H00009019-B01P)

View related products by pathway.

PTMs for MPZL1 Antibody (H00009019-B01P)

Learn more about PTMs related to MPZL1 Antibody (H00009019-B01P).
 

Research Areas for MPZL1 Antibody (H00009019-B01P)

Find related products by research area.

Blogs on MPZL1

There are no specific blogs for MPZL1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our MPZL1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol MPZL1
Entrez
Uniprot