MPV17 Antibody

Images

 
Western Blot: MPV17 Antibody [NBP2-86712] - Host: Rabbit. Target Name: MPV17. Sample Type: ACHN Whole Cell lysates. Antibody Dilution: 1.0ug/ml

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

MPV17 Antibody Summary

Immunogen
The immunogen is a synthetic peptide directed towards the C-terminal region of Human MPV17. Peptide sequence: LDQGGFAPCFLGCFLPLVGALNGLSAQDNWAKLQRDYPDALITNYYLWPA The peptide sequence for this immunogen was taken from within the described region.
Clonality
Polyclonal
Host
Rabbit
Gene
MPV17
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for MPV17 Antibody

  • human homolog of glomerulosclerosis and nephrotic syndrome
  • MpV17 mitochondrial inner membrane protein
  • murine homolog, glomerulosclerosis
  • protein Mpv17

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-52300
Species: Hu, Mu
Applications: ICC, ICC/IF, IHC, IHC-P, WB
NBP1-84256
Species: Hu
Applications: IHC, IHC-P, WB
NBP1-33015
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, KO, WB
6057-NG/CF
Species: Hu
Applications: BA
NBP1-83466
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-2737
Species: Hu
Applications: ICC/IF, IHC, IHC-P, IP, WB
NBP1-76781
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
NBP1-32728
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, WB
NBP1-92505
Species: Hu
Applications: IHC, IHC-P, KD, WB
NBP2-20626
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
NBP1-89827
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-75656
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC-P, WB
NBP1-87769
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
H00171023-M05
Species: Hu
Applications: ELISA, IP, WB
NBP2-37986
Species: Hu
Applications: ICC/IF, IHC, IHC-P
AF2819
Species: Hu
Applications: ICC, WB
NBP2-20486
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, IP, WB
NBP1-06398
Species: Hu, Pm, Rt
Applications: IB, ICC/IF, IHC, IHC-P, WB

Publications for MPV17 Antibody (NBP2-86712) (0)

There are no publications for MPV17 Antibody (NBP2-86712).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MPV17 Antibody (NBP2-86712) (0)

There are no reviews for MPV17 Antibody (NBP2-86712). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for MPV17 Antibody (NBP2-86712) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional MPV17 Products

Bioinformatics Tool for MPV17 Antibody (NBP2-86712)

Discover related pathways, diseases and genes to MPV17 Antibody (NBP2-86712). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MPV17 Antibody (NBP2-86712)

Discover more about diseases related to MPV17 Antibody (NBP2-86712).
 

Pathways for MPV17 Antibody (NBP2-86712)

View related products by pathway.

PTMs for MPV17 Antibody (NBP2-86712)

Learn more about PTMs related to MPV17 Antibody (NBP2-86712).

Blogs on MPV17

There are no specific blogs for MPV17, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our MPV17 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol MPV17