MPHOSPH9- Recombinant Protein Antigen

• Reactivity: Hu
• Applications: AC

MPHOSPH9- Recombinant Protein Antigen Summary

• Description: A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human MPHOSPH9.
  
  

  Source: E. coli

  Amino Acid Sequence: YKSKDPKEFMEHIDVPKGQYVAPAVPAESLVDGVKNENFYIQTPEECHVSLKEDVSISPGEFEHNFLGENKVSEVYSGKTNSNAITSWAQKLKQNQPK

  Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

  This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

• Source: E. coli
• Protein/Peptide Type: Recombinant Protein Antigen
• Gene: MPHOSPH9
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

• Dilutions:
  • Antibody Competition 10 - 100 molar excess
• Application Notes: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-87870.

  It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

  For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

• Theoretical MW: 29 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS and 1M Urea, pH 7.4.
• Preservative: No Preservative
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Alternate Names for MPHOSPH9- Recombinant Protein Antigen

• FLJ12954
• M-phase phosphoprotein 9
• MPP-9
• MPP9DKFZp434J034

Background

MPHOSPH9, also known as M-phase phosphoprotein 9, has 2 isoforms, a 1,031 amino acid isoform 1 that is 116 kDa and a 1,028 amino acid isoform 2 that is 116 kDa, localizes to the distal and proximal end of centriole pairs in duplicated centrosomes, and in ciliated cells, localizes to the distal and proximal end of daughter centriole and proximal of the mother centriole but not in the distal end of the mother centriole. Little is known about its function. Studies on this protein have shown a relationship with the following diseases and disorders: corneal ulcer, rosacea, multiple sclerosis, Fanconi's anemia, anemia, and neuronitis. This protein has also shown an interaction with YWHAG, USP11, SVIL, YWHAZ, WNK1, and UBC in M phase of mitotic cell cycle pathways.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: MPHOSPH9