We're moving to rndsystems.com. Come with us!

After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.

MPHOSPH9- Recombinant Protein Antigen

Images

 
There are currently no images for MPHOSPH9- Protein (NBP1-87870PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

MPHOSPH9- Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human MPHOSPH9.

Source: E. coli

Amino Acid Sequence: YKSKDPKEFMEHIDVPKGQYVAPAVPAESLVDGVKNENFYIQTPEECHVSLKEDVSISPGEFEHNFLGENKVSEVYSGKTNSNAITSWAQKLKQNQPK

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
MPHOSPH9
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-87870.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
29 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for MPHOSPH9- Recombinant Protein Antigen

  • FLJ12954
  • M-phase phosphoprotein 9
  • MPP-9
  • MPP9DKFZp434J034

Background

MPHOSPH9, also known as M-phase phosphoprotein 9, has 2 isoforms, a 1,031 amino acid isoform 1 that is 116 kDa and a 1,028 amino acid isoform 2 that is 116 kDa, localizes to the distal and proximal end of centriole pairs in duplicated centrosomes, and in ciliated cells, localizes to the distal and proximal end of daughter centriole and proximal of the mother centriole but not in the distal end of the mother centriole. Little is known about its function. Studies on this protein have shown a relationship with the following diseases and disorders: corneal ulcer, rosacea, multiple sclerosis, Fanconi's anemia, anemia, and neuronitis. This protein has also shown an interaction with YWHAG, USP11, SVIL, YWHAZ, WNK1, and UBC in M phase of mitotic cell cycle pathways.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

DMP900
Species: Hu
Applications: ELISA
M6000B
Species: Mu
Applications: ELISA
AF1329
Species: Hu, Mu, Rt
Applications: ChIP, CyTOF-ready, ICC, IHC, ICFlow, Simple Western, WB
NBP3-25247
Species: Hu
Applications: ICC/IF
NBP1-86834
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
DTM100
Species: Hu
Applications: ELISA
MAB4069
Species: Hu, Mu, Rt
Applications: WB
AF3667
Species: Hu, Mu
Applications: Dual ISH-IHC, ICC, IHC, Simple Western, WB
NB100-1029
Species: Hu
Applications: IHC,  IHC-P, PEP-ELISA, WB
AF7164
Species: Hu
Applications: WB
H00008099-B01P-50ug
Species: Hu
Applications: ICC/IF, WB
419-ML
Species: Mu
Applications: BA
MMP200
Species: Ca, Hu, Mu, Po, Rt
Applications: ELISA
NB200-109
Species: Hu, Mu
Applications: ChIP, ChIP, CyTOF-ready, Flow, GS, ICC/IF, IP, WB
NB100-94995
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, IP, KD, WB
NB600-1293
Species: Am, Bv, Ca, Ch, Hu, Mu, Rt, Tr
Applications: ICC/IF, IHC, IHC-Fr, Simple Western, Single-Cell Western, WB
H00342184-M07
Species: Hu
Applications: ELISA, ICC/IF, WB
NBP1-87870PEP
Species: Hu
Applications: AC

Publications for MPHOSPH9- Protein (NBP1-87870PEP) (0)

There are no publications for MPHOSPH9- Protein (NBP1-87870PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MPHOSPH9- Protein (NBP1-87870PEP) (0)

There are no reviews for MPHOSPH9- Protein (NBP1-87870PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for MPHOSPH9- Protein (NBP1-87870PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional MPHOSPH9- Products

Research Areas for MPHOSPH9- Protein (NBP1-87870PEP)

Find related products by research area.

Blogs on MPHOSPH9-

There are no specific blogs for MPHOSPH9-, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our MPHOSPH9- Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol MPHOSPH9