MOSC1 Antibody

Images

 
Western Blot: MOSC1 Antibody [NBP1-69519] - This Anti-MOSC1 antibody was used in Western Blot of Placenta tissue lysate at a concentration of 1ug/ml.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

MOSC1 Antibody Summary

Immunogen
Synthetic peptides corresponding to MOSC1(MOCO sulphurase C-terminal domain containing 1) The peptide sequence was selected from the C terminal of MOSC1. Peptide sequence WDELLIGDVELKRVMACSRCILTTVDPDTGVMSRKEPLETLKSYRQCDPS.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
MARC1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against MOSC1 and was validated on Western blot.
Theoretical MW
37 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Control Peptide
MOSC1 Protein (NBP1-69519PEP)

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for MOSC1 Antibody

  • FLJ22390
  • MARC1
  • mitochondrial amidoxime reducing component 1
  • MOCO sulphurase C-terminal domain containing 1
  • MOSC domain-containing protein 1, mitochondrial

Background

The exact function of MOSC1 remains unknown.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-82167
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-88039
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-49284
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-88762
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-06542
Species: Hu
Applications: WB, IHC, IHC-P, IP
AF2898
Species: Mu
Applications: WB, IP
NBP1-89150
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-52979
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-02705
Species: Hu, Ca, Pm
Applications: WB, Flow, IHC, IHC-P
NB300-558
Species: Hu, Rb
Applications: WB, ELISA, ICC/IF, IP
NBP1-32899
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-31302
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-93469
Species: Hu
Applications: IHC, IHC-P
NBP1-85865
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-14243
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBL1-10680
Species: Hu
H00011026-M01
Species: Hu
Applications: WB, ELISA
NBP2-46355
Species: Hu
Applications: WB, IHC
NBP1-69519
Species: Hu
Applications: WB

Publications for MOSC1 Antibody (NBP1-69519) (0)

There are no publications for MOSC1 Antibody (NBP1-69519).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MOSC1 Antibody (NBP1-69519) (0)

There are no reviews for MOSC1 Antibody (NBP1-69519). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for MOSC1 Antibody (NBP1-69519) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional MOSC1 Products

Bioinformatics Tool for MOSC1 Antibody (NBP1-69519)

Discover related pathways, diseases and genes to MOSC1 Antibody (NBP1-69519). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MOSC1 Antibody (NBP1-69519)

Discover more about diseases related to MOSC1 Antibody (NBP1-69519).
 

Pathways for MOSC1 Antibody (NBP1-69519)

View related products by pathway.

Blogs on MOSC1

There are no specific blogs for MOSC1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our MOSC1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol MARC1
Uniprot