Morg1 Antibody - Azide and BSA Free

Western Blot: Morg1 Antibody [H00084292-B01P] - Analysis of MORG1 expression in transfected 293T cell line by MORG1 polyclonal antibody. Lane 1: MORG1 transfected lysate(34.65 KDa). Lane 2: Non-transfected lysate.

Immunocytochemistry/Immunofluorescence: Morg1 Antibody [H00084292-B01P] - Analysis of purified antibody to MORG1 on HeLa cell. (antibody concentration 10 ug/ml)

• Reactivity: Hu
• Applications: WB, ICC/IF
• Clonality: Polyclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

Morg1 Antibody - Azide and BSA Free Summary

• Description: Novus Biologicals Mouse Morg1 Antibody - Azide and BSA Free (H00084292-B01P) is a polyclonal antibody validated for use in WB and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: MORG1 (NP_115708.1, 1 a.a. - 315 a.a.) full-length human protein. MAFPEPKPRPPELPQKRLKTLDCGQGAVRAVRFNVDGNYCLTCGSDKTLKLWNPLRGTLLRTYSGHGYEVLDAAGSFDNSSLCSGGGDKAVVLWDVASGQVVRKFRGHAGKVNTVQFNEEATVILSGSIDSSIRCWDCRSRRPEPVQTLDEARDGVSSVKVSDHEILAGSVDGRVRRYDLRMGQLFSDYVGSPITCTCFSRDGQCTLVSSLDSTLRLLDKDTGELLGEYKGHKNQEYKLDCCLSERDTHVVSCSEDGKVFFWDLVEGALALALPVGSGVVQSLAYHPTEPCLLTAMGGSVQCWREEAYEAEDGAG
• Specificity: MORG1 - mitogen-activated protein kinase organizer 1,
• Isotype: IgG
• Clonality: Polyclonal
• Host: Mouse
• Gene: WDR83
• Purity: Protein A purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence
  • Western Blot 1:500
• Application Notes: Antibody reactive against Recombinant Protein with GST tag on ELISA and Western Blot and also on transfected lysate in western blot. GST tag alone is used as a negative control. It has also been used for immunofluorescence.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.4)
• Preservative: No Preservative
• Purity: Protein A purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Morg1 Antibody - Azide and BSA Free

• MAPK organizer 1
• MGC4238
• MORG1Mitogen-activated protein kinase organizer 1
• WD repeat domain 83
• WD repeat domain-containing protein 83

Background

Mitogen-activated protein kinase organiser 1 (Morg1) is a scaffold protein for various multimeric complexes. It stabilises the assembly of several important components of the ERK pathway including Raf-1 and MEK into an oligomeric complex.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: WDR83
• Entrez:
  • 84292(Human)
• Uniprot:
  • NP_115708.1(Human)