MORF4L2 Antibody - BSA Free

Images

 
Immunocytochemistry/ Immunofluorescence: MORF4L2 Antibody [NBP2-47370] - Staining of human cell line A-431 shows localization to nucleoplasm. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: MORF4L2 Antibody [NBP2-47370] - Staining of human colon tissue. Shows strong nuclear positivity in glandular cells with additional cytoplasmic staining in endothelial cells and peripheral ...read more
Western Blot: MORF4L2 Antibody [NBP2-47370] -Analysis in human cell line MCF-7.
Immunohistochemistry-Paraffin: MORF4L2 Antibody [NBP2-47370] - Staining of human cerebral cortex shows strong nuclear positivity in neurons.
Immunohistochemistry-Paraffin: MORF4L2 Antibody [NBP2-47370] -Staining of human placenta shows strong nuclear positivity positivity in trophoblastic cells.
Immunohistochemistry-Paraffin: MORF4L2 Antibody [NBP2-47370] -Staining of human testis shows strong nuclear positivity in Leydig cells and cells in seminiferous ducts.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Format
BSA Free

Order Details

View Available Formulations
Catalog# & Formulation Size Price

MORF4L2 Antibody - BSA Free Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: MSSRKQGSQPRGQQSAEEENFKKPTRSNMQRSKMRGASSGKKTAGPQQKNLEPALPGRWGGRSAENPPSGSVRKTRK
Predicted Species
Mouse (90%), Rat (90%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
MORF4L2
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
  • Western Blot 0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
MORF4L2 Protein (NBP2-47370PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for MORF4L2 Antibody - BSA Free

  • KIAA0026MRGXProtein MSL3-2
  • MORFL2
  • MORF-related gene X protein
  • mortality factor 4 like 2
  • mortality factor 4-like protein 2
  • MSL3-2 protein
  • Transcription factor-like protein MRGX

Background

Component of the NuA4 histone acetyltransferase (HAT) complex which is involved in transcriptional activation of select genes principally by acetylation of nucleosomal histone H4 and H2A. This modification may both alter nucleosome - DNA interactions and promote interaction of the modified histones with other proteins which positively regulate transcription. This complex may be required for the activation of transcriptional programs associated with oncogene and proto-oncogene mediated growth induction, tumor suppressor mediated growth arrest and replicative senescence, apoptosis, and DNA repair. The NuA4 complex ATPase and helicase activities seem to be, at least in part, contributed by the association of RUVBL1 and RUVBL2 with EP400. NuA4 may also play a direct role in DNA repair when directly recruited to sites of DNA damage. Also component of the MSIN3A complex which acts to repress transcription by deacetylation of nucleosomal histones. Component of the NuA4 histone acetyltransferase complex which contains the catalytic subunit HTATIP/TIP60 and the subunits EP400, TRRAP/PAF400, BRD8/SMAP, EPC1, DMAP1/DNMAP1, RUVBL1/TIP49, RUVBL2, ING3, actin, ACTL6A/BAF53A, MORF4L1/MRG15, MORF4L2/MRGX, MRGBP and YEATS4/GAS41. The NuA4 complex interacts with MYC and the adenovirus E1A protein. MORF4L1 may also participate in the formation of NuA4 related complexes which lack the HTATIP/TIP60 catalytic subunit, but which include the SWI/SNF related protein SRCAP. Component of the MSIN3A histone deacetylase complex, which includes SIN3A, HDAC2, ARID4B, MORF4L1, RBBP4/RbAp48, and RBBP7/RbAp46. MORF4L1 interacts with RB1 and MYST1. MORF4L1 may also interact with PHF12 and one or more as yet undefined members of the TLE (transducin-like enhancer of split) family of transcriptional repressors. MRGX plays a role in growth regulation and replicative senescence. Expression of MRGX, which initially increases during cell cycle, may have to decrease for cells to enter the S phase.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-1307
Species: Hu, Mu, Po, Rt
Applications: IHC,  IHC-P, PEP-ELISA, WB
H00004605-M02
Species: Hu
Applications: ELISA, ICC/IF, S-ELISA, WB
AF816
Species: Hu
Applications: ICC, IHC, WB
AF3166
Species: Hu
Applications: IHC, Simple Western, WB
NBP3-25721
Species: Ca, Fe, Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
MAB6495
Species: Hu
Applications: ICC, Simple Western, WB
NBP3-26148
Species: Hu, Rt
Applications: ELISA, Flow, ICC/IF, WB
NBP2-45952
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, WB
NB110-75035
Species: Ha(-), Hu, Mu
Applications: ICC/IF, IHC, KD, Single-Cell Western, WB
NBP3-27150
Species: Hu
Applications: ELISA, WB
NBP1-84936
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP3-47052
Species: Hu
Applications: ELISA, IHC, WB
NB100-56618
Species: Hu, Mu
Applications: Flow-CS, Flow, ICC/IF, IHC,  IHC-P, WB
NB100-360
Species: Hu, Mu, Rt
Applications: IB, ICC/IF, IHC,  IHC-P, IP, WB
2695-SE
Species: Hu
Applications: EnzAct
NBP3-14409
Species: Hu
Applications: IHC,  IHC-P
NB100-56340
Species: Hu, Mu, Rt
Applications: IHC, IHC-Fr,  IHC-P, KO, Simple Western, WB
MAB4375
Species: Hu, Mu, Rt
Applications: IHC
NBP1-85482
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-47370
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC

Publications for MORF4L2 Antibody (NBP2-47370) (0)

There are no publications for MORF4L2 Antibody (NBP2-47370).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MORF4L2 Antibody (NBP2-47370) (0)

There are no reviews for MORF4L2 Antibody (NBP2-47370). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for MORF4L2 Antibody (NBP2-47370) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional MORF4L2 Products

Research Areas for MORF4L2 Antibody (NBP2-47370)

Find related products by research area.

Blogs on MORF4L2

There are no specific blogs for MORF4L2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our MORF4L2 Antibody - BSA Free and receive a gift card or discount.

Bioinformatics

Gene Symbol MORF4L2