Mohawk homeobox Antibody - BSA Free Summary
| Description |
The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution. |
| Immunogen |
Synthetic peptide towards mohawk homebox. Peptide sequence GDSAANRRGPSKDDTYWKEINAAMALTNLAQGKDEVQGTTTSCIIQKSSH. The peptide sequence for this immunogen was taken from within the described region. |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
MKX |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS, 2% Sucrose |
| Preservative |
0.09% Sodium Azide |
| Concentration |
0.5 mg/ml |
| Purity |
Affinity purified |
Alternate Names for Mohawk homeobox Antibody - BSA Free
Background
MKX is a member of an Iroquois (IRX) family-related class of 'three-amino acid loop extension' (TALE)atypical homeobox proteins characterized by 3 additional amino acids in the loop region between helix I and helix IIof the homeodomain (Anderson et al., 2006 (PubMed 16408284)).(supplied by OMIM)
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: CyTOF-ready, ICFlow, Simple Western, WB
Species: Hu
Applications: Simple Western, WB
Species: Mu
Applications: ELISA
Species: Hu
Applications: CyTOF-ready, Flow-CS, Flow, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: ELISA, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ChIP-EXO-SEQ, IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Mu
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Po
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ICC, WB
Species: Hu
Applications: BA
Species: Hu
Applications: ICC, IHC, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P
Species: Mu
Applications: IHC, Neut, WB
Publications for Mohawk homeobox Antibody (NBP1-82408) (0)
There are no publications for Mohawk homeobox Antibody (NBP1-82408).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for Mohawk homeobox Antibody (NBP1-82408) (0)
There are no reviews for Mohawk homeobox Antibody (NBP1-82408).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for Mohawk homeobox Antibody (NBP1-82408) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional Mohawk homeobox Products
Blogs on Mohawk homeobox