MOGAT3 Antibody (3F7) [7C] Summary
| Immunogen |
MOGAT3 (NP_835470, 59 a.a. ~ 107 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. YLVWLYVDWDTPNQGGRRSEWIRNRAIWRQLRDYYPVKLVKTAELPPDR |
| Specificity |
MOGAT3 - monoacylglycerol O-acyltransferase 3 |
| Isotype |
IgG1 Kappa |
| Clonality |
Monoclonal |
| Host |
Mouse |
| Gene |
MOGAT3 |
| Purity |
IgG purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- ELISA
- Immunocytochemistry/ Immunofluorescence
- Western Blot
|
Reactivity Notes
Human. Other species not tested.
Packaging, Storage & Formulations
| Storage |
Store at 4C in the dark. |
| Buffer |
PBS |
| Preservative |
0.05% Sodium Azide |
| Purity |
IgG purified |
Notes
Dylight (R) is a trademark of Thermo Fisher Scientific Inc. and its subsidiaries.
This product is produced by and distributed for Abnova, a company based in Taiwan.
Alternate Names for MOGAT3 Antibody (3F7) [7C]
Background
Acyl-CoA:monoacylglycerol acyltransferase (MOGAT; EC 2.3.1.22) catalyzes the synthesis of diacylglycerol from 2-monoacylglycerol and fatty acyl-CoA (Cheng et al., 2003 [PubMed 12618427]).[supplied by OMIM]
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: EnzAct
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ELISA, Flow, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: IHC, KO, WB
Species: Hu, Mu, Rt
Applications: IB, ICC/IF, Simple Western, WB
Species: Rt
Applications: BA
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-Fr, IHC-P, WB
Species: Ca, Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Ba, Hu, Pm, Mu, Rt
Applications: DB, ELISA, IB, ICC/IF, IHC-FrFl, IHC, IHC-Fr, IHC-P, IP, WB
Species: Hu, Mu, Rt
Applications: WB
Species: Hu
Applications: ICC, WB
Species: Hu, Mu
Applications: CyTOF-ready, Dual ISH-IHC, Flow, ICC, IHC, Simple Western, WB
Publications for MOGAT3 Antibody (H00346606-M05V2) (0)
There are no publications for MOGAT3 Antibody (H00346606-M05V2).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for MOGAT3 Antibody (H00346606-M05V2) (0)
There are no reviews for MOGAT3 Antibody (H00346606-M05V2).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for MOGAT3 Antibody (H00346606-M05V2) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional MOGAT3 Products
Blogs on MOGAT3