MOCS3 Antibody [PE]

• Reactivity: Hu, Mu
• Applications: WB, ELISA
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: PE

MOCS3 Antibody [PE] Summary

• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 271-460 of human MOCS3 (NP_055299.1).
  
  Sequence:
  YSGSLLLFDALRGHFRSIRLRSRRLDCAACGERPTVTDLLDYEAFCGSSATDKCRSLQLLSPEERVSVTDYKRLLDSGAFHLLLDVRPQVEVDICRLPHALHIPLKHLERRDAESLKLLKEAIWEEKQGTQEGAAVPIYVICKLGNDSQKAVKILQSLSAAQELDPLTVRDVVGGLMAWAAKIDGTFPQY
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: MOCS3
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Western Blot
• Application Notes: Optimal dilution of this antibody should be experimentally determined.

Packaging, Storage & Formulations

• Storage: Store at 4C in the dark.
• Buffer: PBS
• Preservative: 0.05% Sodium Azide
• Purity: Affinity purified

Alternate Names for MOCS3 Antibody [PE]

• adenylyltransferase and sulfurtransferase MOCS3
• dJ914P20.3
• molybdenum cofactor synthesis 3
• Molybdenum cofactor synthesis protein 3
• Molybdopterin synthase sulfurylase
• MPT synthase sulfurylase
• UBA4, ubiquitin-activating enzyme E1 homolog
• UBA4MGC9252
• ubiquitin-like modifier activating enzyme 4

Background

Molybdenum cofactor (MoCo) is necessary for the function of all molybdoenzymes. One of the enzymes required for the biosynthesis of MoCo is molybdopterin synthase (MPT synthase). The protein encoded by this gene adenylates and activates MPT synthase. This gene contains no introns. A pseudogene of this gene is present on chromosome 14.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: MOCS3