MNF1 Antibody


Western Blot: MNF1 Antibody [NBP2-14240] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
Immunocytochemistry/ Immunofluorescence: MNF1 Antibody [NBP2-14240] - Immunofluorescent staining of human cell line U-2 OS shows localization to nuclear bodies & mitochondria.
Immunohistochemistry-Paraffin: MNF1 Antibody [NBP2-14240] - Staining of human bone marrow shows strong cytoplasmic positivity in fraction of hematopoietic cells.

Product Details

Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P

Order Details

MNF1 Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: NYYKHKYPRPRDTSFSGLSLEEYKLILSTDTLEELKEIDKGMWKKLQEKF APKGPEADDKA
Specificity of human MNF1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:1000-1:2500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. For Immunofluorescence, Fixation/Permeabilization: PFA/Triton X-100.
Positive Control
MNF1 Lysate (NBP2-65960)
Control Peptide
MNF1 Protein (NBP2-14240PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (82%)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for MNF1 Antibody

  • bA6B20.2
  • breast cancer associated protein SGA-81M
  • Breast cancer-associated protein SGA-81M
  • C6orf125
  • Cbp6
  • chromosome 6 open reading frame 125
  • hypothetical protein LOC84300
  • M19
  • MGC14833
  • mitochondrial nucleoid factor 1
  • MNF1


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB, Simple Western, IHC
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Rt
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu
Applications: WB, IHC, CyTOF-ready, ICFlow
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP, IHC-FrFl
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC-P, IP
Species: Hu, Mu
Applications: WB, Simple Western, CyTOF-ready, ICC, ICFlow, KO
Species: Mu
Applications: WB, IHC, IP
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for MNF1 Antibody (NBP2-14240) (0)

There are no publications for MNF1 Antibody (NBP2-14240).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MNF1 Antibody (NBP2-14240) (0)

There are no reviews for MNF1 Antibody (NBP2-14240). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for MNF1 Antibody (NBP2-14240) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Positive Control Lysate(s)

Secondary Antibodies


Isotype Controls

Additional MNF1 Products

Bioinformatics Tool for MNF1 Antibody (NBP2-14240)

Discover related pathways, diseases and genes to MNF1 Antibody (NBP2-14240). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MNF1 Antibody (NBP2-14240)

Discover more about diseases related to MNF1 Antibody (NBP2-14240).

Pathways for MNF1 Antibody (NBP2-14240)

View related products by pathway.

Blogs on MNF1

There are no specific blogs for MNF1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our MNF1 Antibody and receive a gift card or discount.


Gene Symbol MNF1