MNF1 Antibody - BSA Free

Western Blot: MNF1 Antibody [NBP2-14240] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp

Immunocytochemistry/Immunofluorescence: MNF1 Antibody [NBP2-14240] - Staining of human cell line U-2 OS shows localization to nuclear bodies & mitochondria. Antibody staining is shown in green.

Immunohistochemistry-Paraffin: MNF1 Antibody [NBP2-14240] - Staining of human bone marrow shows strong cytoplasmic positivity in fraction of hematopoietic cells.

• Reactivity: Hu
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

MNF1 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to the amino acids: NYYKHKYPRPRDTSFSGLSLEEYKLILSTDTLEELKEIDKGMWKKLQEKFAPKGPEADDKA
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: UQCC2
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:1000 - 1:2500
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation/Permeabilization: PFA/Triton X-100.
• Control Peptide:

  MNF1 Protein (NBP2-14240PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (82%)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for MNF1 Antibody - BSA Free

• bA6B20.2
• breast cancer associated protein SGA-81M
• Breast cancer-associated protein SGA-81M
• C6orf125
• Cbp6
• chromosome 6 open reading frame 125
• hypothetical protein LOC84300
• M19
• MGC14833
• mitochondrial nucleoid factor 1
• MNF1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for MNF1 Antibody (NBP2-14240)(1)

Publication using NBP2-14240

• Chojnacka KJ, Elancheliyan P, Mussulini BHM et al. Ovarian carcinoma immunoreactive antigen-like protein 2 (OCIAD2) is a novel complex III-specific assembly factor in mitochondria Molecular biology of the cell 2022-04-01 [PMID: 35080992]

Bioinformatics

• Gene Symbol: UQCC2