MMRN1 Recombinant Protein Antigen

• Reactivity: Hu
• Applications: AC

MMRN1 Recombinant Protein Antigen Summary

• Description: A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human MMRN1.
  
  

  Source: E. coli

  Amino Acid Sequence: RHNLLRNEVQGRDDALERRINEYALEMEDGLNKTMTIINNAIDFIQDNYALKETLSTIKDNSEIHHKCTSDMETILTFIPQFHRLND

  Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

  This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

• Source: E. coli
• Protein/Peptide Type: Recombinant Protein Antigen
• Gene: MMRN1
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

• Dilutions:
  • Antibody Competition 10 - 100 molar excess
• Application Notes: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-84014.

  It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

  For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

• Theoretical MW: 28 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS and 1M Urea, pH 7.4.
• Preservative: No Preservative
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Alternate Names for MMRN1 Recombinant Protein Antigen

• ECMmultimerin
• Elastin microfibril interface located protein 4
• Elastin microfibril interfacer 4
• EMILIN-4
• EMILIN4GPIa*
• Endothelial cell multimerin
• glycoprotein Ia*
• GPIA*
• MMRN
• multimerin 1
• multimerin-1

Background

MMRN1, also known as Multimerin-1, has 2 isoforms, a 1,228 amino acid long isoform that is 138 kDa and a short 531 amino acid isoform that is 58 kDa; synthesized by endothelial cells and megakaryocytes: stored in platelet alpha granules and endothelial cell Weibel-Palade bodies; can be found in vascular tissues such as placenta, lung, and liver. It is comprised of subunits linked by interchain disulfide bonds to form large, variably sized homomultimers; it is a factor V/Va-binding protein and may function as a carrier protein for platelet factor V and as an extracellular matrix or adhesive protein. Studies on this protein have shown a relationship with the following diseases and disorders: bleeding disorder, quebec platelet disorder, neonatal alloimmune thrombocytopenia, von Willebrand's disease, polycythemia vera, myocardial infarction, atrial fibrillation, thrombocytopenia, polycythemia, vascular disease, diabetic retinopathy, thrombosis, periodontitis, periodontal disease, hepatitis b, Parkinson's disease, vaginitis, asthma, and colorectal cancer. The MMRN1 protein has also shown an interaction with CDKN2A, F5, APC, A2M, ALB, and 30 other proteins in hemostasis, platelet degranulation, platelet activation, signaling and aggregation, and response to elevated platelet cytosolic Ca2+ pathways.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Bioinformatics

• Gene Symbol: MMRN1