Recombinant Human MMRN1 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human MMRN1 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 291-390 of Human MMRN1 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:IHTNQAESHTAVGRGVAEQQQQQGCGDPEVMQKMTDQVNYQAMKLTLLQKKIDNISLTVNDVRNTYSSLEGKVSEDKSREFQSLLKGLKSKSINVLIRDI

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
MMRN1

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.
Publications
Read Publication using H00022915-Q01.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human MMRN1 Protein

  • ECMmultimerin
  • Elastin microfibril interface located protein 4
  • Elastin microfibril interfacer 4
  • EMILIN-4
  • EMILIN4GPIa*
  • Endothelial cell multimerin
  • glycoprotein Ia*
  • GPIA*
  • MMRN
  • multimerin 1
  • multimerin-1

Background

MMRN1 - multimerin 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-26380
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-25162
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
NBP2-36776
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-88527
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-88526
Species: Hu
Applications: WB, IHC, IHC-P
NB600-586
Species: Hu
Applications: ICC/IF, IHC, IHC-P
AF5745
Species: Hu
Applications: WB, IHC
NBP1-33320
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-84127
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-30584
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-88114
Species: Hu
Applications: ICC/IF, IHC, IHC-P
AF-386-PB
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
NBP1-81858
Species: Hu
Applications: WB, IHC, IHC-P
AF1219
Species: Hu, Mu, Rt
Applications: WB, Simple Western, Flow, CyTOF-ready, ICC
NBP1-89441
Species: Hu
Applications: ICC/IF, IHC, IHC-P, ICC
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
NBP2-03256
Species: Hu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-83977
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB300-119
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
H00022915-Q01
Species: Hu
Applications: WB, ELISA, PA

Publications for MMRN1 Partial Recombinant Protein (H00022915-Q01)(1)

Reviews for MMRN1 Partial Recombinant Protein (H00022915-Q01) (0)

There are no reviews for MMRN1 Partial Recombinant Protein (H00022915-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for MMRN1 Partial Recombinant Protein (H00022915-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional MMRN1 Products

Bioinformatics Tool for MMRN1 Partial Recombinant Protein (H00022915-Q01)

Discover related pathways, diseases and genes to MMRN1 Partial Recombinant Protein (H00022915-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MMRN1 Partial Recombinant Protein (H00022915-Q01)

Discover more about diseases related to MMRN1 Partial Recombinant Protein (H00022915-Q01).
 

Pathways for MMRN1 Partial Recombinant Protein (H00022915-Q01)

View related products by pathway.

PTMs for MMRN1 Partial Recombinant Protein (H00022915-Q01)

Learn more about PTMs related to MMRN1 Partial Recombinant Protein (H00022915-Q01).

Blogs on MMRN1

There are no specific blogs for MMRN1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

NK1R Antibody
NB300-119
MMRN1 Antibody
NBP1-84014

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human MMRN1 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol MMRN1