MMP-16/MT3-MMP Antibody

Images

 
Immunohistochemistry-Paraffin: MMP-16/MT3-MMP Antibody [NBP1-86721] - Staining of human hippocampus shows moderate cytoplasmic positivity in neuronal cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

MMP-16/MT3-MMP Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:TTLQPGYPHDLITLGSGIPPHGIDSAIWWEDVGKTYFFKGDRYWRYSEEMKTMDPGYPKPITVWKGIPESPQGAFVHKENGFTYFYKGKEYWKFNNQILKVEPGYPRSILKDFMGCD
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (98%), Rat (98%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
MMP16
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Publications
Read Publication using NBP1-86721.

Reactivity Notes

Reactivity reported in scientific literature (PMID: 23435261)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for MMP-16/MT3-MMP Antibody

  • chromosome 8 open reading frame 57
  • DKFZp761D112
  • EC 3.4.24
  • EC 3.4.24.-
  • EC 3.4.24.80
  • matrix metallopeptidase 16 (membrane-inserted)
  • matrix metalloproteinase 16 (membrane-inserted)
  • matrix metalloproteinase-16
  • Membrane-type matrix metalloproteinase 3
  • Membrane-type-3 matrix metalloproteinase
  • MMP16
  • MMP-16
  • MMPX2
  • MMP-X2
  • MT3MMP
  • MT3-MMP
  • MT3-MMPC8orf57
  • MT-MMP 3
  • MT-MMP2
  • MTMMP3
  • MT-MMP3
  • Putative transmembrane protein C8orf57

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB9181
Species: Hu
Applications: WB, Flow, IHC, IP, CyTOF-ready
MAB9161
Species: Hu
Applications: WB, IHC, CyTOF-ready, ICFlow
NB200-193
Species: Hu, Mu, Rt, Ch, GP
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
MAB7796
Species: Hu
Applications: Neut
AB924
Species: Hu, Mu
Applications: WB, IHC, IP
NBP1-28912
Species: Hu
Applications: WB, PEP-ELISA
H00004498-R01
Species: Hu
NBP1-86721
Species: Hu, Mu, Rt
Applications: IHC, IHC-P

Publications for MMP-16/MT3-MMP Antibody (NBP1-86721)(1)

Reviews for MMP-16/MT3-MMP Antibody (NBP1-86721) (0)

There are no reviews for MMP-16/MT3-MMP Antibody (NBP1-86721). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for MMP-16/MT3-MMP Antibody (NBP1-86721) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional MMP-16/MT3-MMP Products

Bioinformatics Tool for MMP-16/MT3-MMP Antibody (NBP1-86721)

Discover related pathways, diseases and genes to MMP-16/MT3-MMP Antibody (NBP1-86721). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MMP-16/MT3-MMP Antibody (NBP1-86721)

Discover more about diseases related to MMP-16/MT3-MMP Antibody (NBP1-86721).
 

Pathways for MMP-16/MT3-MMP Antibody (NBP1-86721)

View related products by pathway.

PTMs for MMP-16/MT3-MMP Antibody (NBP1-86721)

Learn more about PTMs related to MMP-16/MT3-MMP Antibody (NBP1-86721).

Blogs on MMP-16/MT3-MMP

There are no specific blogs for MMP-16/MT3-MMP, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our MMP-16/MT3-MMP Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol MMP16
Entrez