MMP-16/MT3-MMP Antibody

Images

 
Western Blot: MMP16 Antibody [NBP1-69349] - This Anti-MMP16 antibody was used in Western Blot of MCF7 tissue lysate at a concentration of 1ug/ml.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

MMP-16/MT3-MMP Antibody Summary

Immunogen
Synthetic peptides corresponding to MMP16(matrix metallopeptidase 16 (membrane-inserted)) The peptide sequence was selected from the N terminal of MMP16 (NP_005932). Peptide sequence ALAAMQQFYGINMTGKVDRNTIDWMKKPRCGVPDQTRGSSKFHIRRKRYA.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
MMP16
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.2-1 ug/ml
Application Notes
This is a rabbit polyclonal antibody against MMP16 and was validated on Western blot.
Theoretical MW
56 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for MMP-16/MT3-MMP Antibody

  • chromosome 8 open reading frame 57
  • DKFZp761D112
  • EC 3.4.24
  • EC 3.4.24.-
  • EC 3.4.24.80
  • matrix metallopeptidase 16 (membrane-inserted)
  • matrix metalloproteinase 16 (membrane-inserted)
  • matrix metalloproteinase-16
  • Membrane-type matrix metalloproteinase 3
  • Membrane-type-3 matrix metalloproteinase
  • MMP16
  • MMP-16
  • MMPX2
  • MMP-X2
  • MT3MMP
  • MT3-MMP
  • MT3-MMPC8orf57
  • MT-MMP 3
  • MT-MMP2
  • MTMMP3
  • MT-MMP3
  • Putative transmembrane protein C8orf57

Background

Proteins of the matrix metalloproteinase (MMP) family are involved in the breakdown of extracellular matrix in normal physiological processes, such as embryonic development, reproduction, and tissue remodeling, as well as in disease processes, such as arthritis and metastasis. Most MMP's are secreted as inactive proproteins which are activated when cleaved by extracellular proteinases. This gene produces at least two transcripts, one which encodes a membrane-bound form and another soluble form of the protein. Both forms of the protein activate MMP2 by cleavage.Proteins of the matrix metalloproteinase (MMP) family are involved in the breakdown of extracellular matrix in normal physiological processes, such as embryonic development, reproduction, and tissue remodeling, as well as in disease processes, such as arthritis and metastasis. Most MMP's are secreted as inactive proproteins which are activated when cleaved by extracellular proteinases. This gene produces at least two transcripts, one which encodes a membrane-bound form and another a soluble form of the protein. Both forms of the protein activate MMP2 by cleavage. This gene was once referred to as MT-MMP2, but was renamed as MT-MMP3 or MMP16.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB9181
Species: Hu
Applications: WB, Flow, IHC, IP, CyTOF-ready
MAB9161
Species: Hu
Applications: WB, IHC, CyTOF-ready, ICFlow
NB200-193
Species: Hu, Mu, Rt, Ch, GP
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
MAB7796
Species: Hu
Applications: Neut
AB924
Species: Hu, Mu
Applications: WB, IHC, IP
NBP1-28912
Species: Hu
Applications: WB, PEP-ELISA
H00004498-R01
Species: Hu
NBP1-69349
Species: Hu
Applications: WB

Publications for MMP-16/MT3-MMP Antibody (NBP1-69349) (0)

There are no publications for MMP-16/MT3-MMP Antibody (NBP1-69349).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MMP-16/MT3-MMP Antibody (NBP1-69349) (0)

There are no reviews for MMP-16/MT3-MMP Antibody (NBP1-69349). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for MMP-16/MT3-MMP Antibody (NBP1-69349) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional MMP-16/MT3-MMP Products

Bioinformatics Tool for MMP-16/MT3-MMP Antibody (NBP1-69349)

Discover related pathways, diseases and genes to MMP-16/MT3-MMP Antibody (NBP1-69349). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MMP-16/MT3-MMP Antibody (NBP1-69349)

Discover more about diseases related to MMP-16/MT3-MMP Antibody (NBP1-69349).
 

Pathways for MMP-16/MT3-MMP Antibody (NBP1-69349)

View related products by pathway.

PTMs for MMP-16/MT3-MMP Antibody (NBP1-69349)

Learn more about PTMs related to MMP-16/MT3-MMP Antibody (NBP1-69349).

Blogs on MMP-16/MT3-MMP

There are no specific blogs for MMP-16/MT3-MMP, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our MMP-16/MT3-MMP Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol MMP16
Entrez
Uniprot