MMP-15/MT2-MMP Recombinant Protein Antigen

• Reactivity: Hu
• Applications: AC

MMP-15/MT2-MMP Recombinant Protein Antigen Summary

• Description: A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human MMP15.
  
  

  Source: E. coli

  Amino Acid Sequence: RDFMGCQEHVEPGPRWPDVARPPFNPHGGAEPGADSAEGDVGDGDGDFGAGVNKDGGSRVVVQMEEVARTVNVVMV

  Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

  This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

• Source: E. coli
• Protein/Peptide Type: Recombinant Protein Antigen
• Gene: MMP15
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

• Dilutions:
  • Antibody Competition 10 - 100 molar excess
• Application Notes: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-32613.

  It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

  For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

• Theoretical MW: 26 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS and 1M Urea, pH 7.4.
• Preservative: No Preservative
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Alternate Names for MMP-15/MT2-MMP Recombinant Protein Antigen

• EC 3.4.24
• EC 3.4.24.-
• EC 3.4.24.80
• matrix metallopeptidase 15 (membrane-inserted)
• matrix metalloproteinase 15 (membrane-inserted)
• Membrane-type matrix metalloproteinase 2
• Membrane-type-2 matrix metalloproteinase
• MMP15
• MMP-15
• MT2-MMP
• MT2-MMPMT2MMP
• MTMMP2MT-MMP 2
• SMCP-2matrix metalloproteinase-15

Background

MMPs are a group of enzymes involved in matrix degradation. Of the sixteen members of matrix metalloproteinase family ten exist in soluble form whereas MT MMPs exist as integral membrane proteins. MT1 MMp, MT2 MMP and MT3 MMP also known as MMP 14, MMP 15 and MMP 16 respectively. They contain a C-terminal transmembrane domain anchoring them to the cell surface. MT2 MMP plays a minor role in activation of pro-MMP 2 to its active form in breast carcinomas. Coexpression of MT1 MMP and MT2 MMP in advanced stages of breast carcinomas is indicative of possible involvement of MT2 MMP in its metastasis.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Bioinformatics

• Gene Symbol: MMP15