Recombinant Human MLXIP GST (N-Term) Protein

Images

 
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, AP

Order Details

Recombinant Human MLXIP GST (N-Term) Protein Summary

Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 481-577 of Human MLXIP

Source: Wheat Germ (in vitro)

Amino Acid Sequence: PSVITHTASATLTHDAPATTFSQSQGLVITTHHPAPSAAPCGLALSPVTRPPQPRLTFVHPKPVSLTGGRPKQPHKIVPAPKPEPVSLVLKNARIAP

Preparation
Method
in vitro wheat germ expression system
Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Partial Recombinant Protein
Gene
MLXIP
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Theoretical MW
36.41 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human MLXIP GST (N-Term) Protein

  • bHLHe36BHLHE36
  • Class E basic helix-loop-helix protein 36
  • KIAA0867MondoA
  • MIRMLX-interacting protein
  • MLX interacting protein
  • MONDOAMlx interactor
  • Transcriptional activator MondoA

Background

MONDOA forms heterodimers with MLX (MIM 602976) that can bind to and activate transcription from CACGTG E boxes (Billin et al., 2000 [PubMed 11073985]).[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-92190
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, KD
NBP1-89979
Species: Hu
Applications: IHC, IHC-P
NBP2-24509
Species: Hu, Mu, Rt, Bv, Ca, Ma-Op, Pm
Applications: WB, IHC, IHC-P
AF1034
Species: Mu, Rt
Applications: WB, Simple Western, IHC
NB100-308
Species: Hu, Mu
Applications: WB, Func, ICC/IF, IP, In vitro, KO
NB400-135
Species: Hu, Mu, Rt
Applications: WB, ChIP, GS, ICC/IF, IHC, IHC-P, IP, KO
NBP2-03417
Species: Hu
Applications: WB, Flow, IHC, IHC-P
NB100-56585
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-87730
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, KD
NBP1-54578
Species: Hu, Mu, Rt
Applications: WB, Flow, IHC, IHC-Fr, IHC-P, IP, PLA, CyTOF-ready, KO
NBP2-74210
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready
AF4186
Species: Hu
Applications: WB, ICC
NBP1-32870
Species: Hu, Ch
Applications: WB, IHC, IHC-P, IP, KD
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-85237
Species: Hu
Applications: IHC, IHC-Fr, IHC-P
NBP1-88071
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P
AF1927
Species: Hu
Applications: WB, IP, ICC

Publications for MLXIP Partial Recombinant Protein (H00022877-Q01) (0)

There are no publications for MLXIP Partial Recombinant Protein (H00022877-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MLXIP Partial Recombinant Protein (H00022877-Q01) (0)

There are no reviews for MLXIP Partial Recombinant Protein (H00022877-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for MLXIP Partial Recombinant Protein (H00022877-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Other Available Formats

Additional MLXIP Products

Array H00022877-Q01

Bioinformatics Tool for MLXIP Partial Recombinant Protein (H00022877-Q01)

Discover related pathways, diseases and genes to MLXIP Partial Recombinant Protein (H00022877-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MLXIP Partial Recombinant Protein (H00022877-Q01)

Discover more about diseases related to MLXIP Partial Recombinant Protein (H00022877-Q01).
 

Pathways for MLXIP Partial Recombinant Protein (H00022877-Q01)

View related products by pathway.

Blogs on MLXIP

There are no specific blogs for MLXIP, but you can read our latest blog posts.

Customers Who Bought This Also Bought

CHREBP Antibody
NB400-135

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human MLXIP GST (N-Term) Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol MLXIP