Recombinant Human MLLT6 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human MLLT6 Protein Summary

Description
Recombinant protein with GST-tag at N-terminal corresponding to the amino acids 1 - 462 of Human MLLT6 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MGAVNPLLSQAESSHTEPDLEDCSFRCRGTSPQESLSSMSPISSLPALFDQTASAPCGGGQLDPAAPGTTNMEQLLEKQGDGEAGVNIVEMLKALHALQKENQRLQEQILSLTAKKERLQILNVQLSVPFPALPAALPAANGPVPGPYGLPPQAGSSDSLSTSKSPPGKSSLGLDNSLSTSSEDPHSGCPSRSSSSLSFHSTPPPLPLLQQSPATLPLALPGAPAPLPPQPQNGLGRAPGAAGLGAMPMAEGLLGGLAGSGGLPLNGLLGGLNGAAAPNPASLSQAGGAPTLQLPGCLNSLTEQQRHLLQQQEQQLQQLQQLLASPQLTPEHQTVVYQMIQQIQQKRELQRLQMAGGSQLPMASLLAGSSTPLLSAGTPGLLPTASAPPLLPAGALVAPSLGNNTSLMAAAAAAAAVAAAGGPPVLTAQTNPFLSLSGAEGSGGGPKGGTADKGASANQEKG

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Recombinant Protein
Gene
MLLT6

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human MLLT6 Protein

  • AF17Myeloid/lymphoid or mixed-lineage leukemia, translocated to, 6
  • ALL1-fused gene from chromosome 17 protein
  • FLJ23480
  • myeloid/lymphoid or mixed-lineage leukemia (trithorax (Drosophila) homolog);translocated to, 6
  • myeloid/lymphoid or mixed-lineage leukemia (trithorax homolog); translocatedto, 6
  • myeloid/lymphoid or mixed-lineage leukemia (trithorax homolog, Drosophila);translocated to, 6
  • protein AF-17
  • trithorax homolog

Background

MLLT6( AAH07237, 1 a.a. - 463 a.a.) recombinant protein with GST.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB600-248
Species: Hu
Applications: WB, IP
NB100-2628
Species: Hu, Mu
Applications: WB, ELISA, Flow, IHC, IP, CyTOF-ready
NB100-1566
Species: Hu
Applications: WB, IP
NBP2-15620
Species: Hu
Applications: WB
NB100-40845
Species: Hu, Mu
Applications: WB, ChIP, IHC-P, IP
NBP1-28728
Species: Hu
Applications: IP (-), WB, IHC
NBP1-84840
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB500-171
Species: Hu, Mu, Rt, Xp, Ye
Applications: WB, ChIP, ICC/IF, IHC, IHC-P
AF7829
Species: Hu
Applications: WB, IHC, ICC
NBP1-88351
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-13294
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-13955
Species: Hu
Applications: IHC, IHC-P
MAB8480
Species: Hu
Applications: WB, Simple Western, ICC, ICFlow
NBP1-91258
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NB100-74357
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF
NBP1-19048
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-54467
Species: Hu, Mu, Rt, Ch, Pm
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, IP
H00057804-M01A
Species: Hu
Applications: WB, ELISA
NBP2-49672
Species: Hu
Applications: IHC
H00004302-P01
Species: Hu
Applications: WB, ELISA, PA

Publications for MLLT6 Recombinant Protein (H00004302-P01) (0)

There are no publications for MLLT6 Recombinant Protein (H00004302-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MLLT6 Recombinant Protein (H00004302-P01) (0)

There are no reviews for MLLT6 Recombinant Protein (H00004302-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for MLLT6 Recombinant Protein (H00004302-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional MLLT6 Products

Bioinformatics Tool for MLLT6 Recombinant Protein (H00004302-P01)

Discover related pathways, diseases and genes to MLLT6 Recombinant Protein (H00004302-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MLLT6 Recombinant Protein (H00004302-P01)

Discover more about diseases related to MLLT6 Recombinant Protein (H00004302-P01).
 

Pathways for MLLT6 Recombinant Protein (H00004302-P01)

View related products by pathway.

PTMs for MLLT6 Recombinant Protein (H00004302-P01)

Learn more about PTMs related to MLLT6 Recombinant Protein (H00004302-P01).

Blogs on MLLT6

There are no specific blogs for MLLT6, but you can read our latest blog posts.

Customers Who Bought This Also Bought

MLLT6 Antibody
NBP1-89222

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human MLLT6 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol MLLT6