MLKL Antibody

Images

 
Western Blot: MLKL Antibody [NBP1-56729] - Human fetal kidney lysate, concentration 0.2-1 ug/ml.
Western Blot: MLKL Antibody [NBP1-56729] - 293T Whole Cell lysates, Antibody Dilution: 1 ug/ml.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IP
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

MLKL Antibody Summary

Immunogen
Synthetic peptides corresponding to MLKL(mixed lineage kinase domain-like) The peptide sequence was selected from the N terminal of MLKL (NP_689862). Peptide sequence DVWKELSLLLQVEQRMPVSPISQGASWAQEDQQDADEDRRAFQMLRRDNE.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
MLKL
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.2-1 ug/ml
  • Immunoprecipitation 1:10-1:500
Application Notes
This is a rabbit polyclonal antibody against MLKL and was validated on Western blot. Immunoprecipitation was reported in scientific literature.
Theoretical MW
54 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Positive Control
MLKL Lysate (NBP2-66280)
Publications
Read Publications using
NBP1-56729 in the following applications:

  • IP
    1 publication
  • WB
    3 publications

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for MLKL Antibody

  • FLJ34389
  • mixed lineage kinase domain-like protein
  • mixed lineage kinase domain-like
  • MLKL

Background

The specific function of this protein remains unknown.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-77299
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-77077
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, IHC-P, IF
NBP2-02293
Species: Hu, Rt, Ca
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-87826
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP2-16015
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-13913
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56344
Species: Hu, Mu, Rt
Applications: WB
NB110-55288
Species: Hu, Mu, Rt, Fi, Pm
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, IP
NBP1-92257
Species: Hu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, KD
NBP1-84074
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-13732
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, KD
NBP2-43728
Species: Hu
Applications: WB, ICC/IF
MAB17761
Species: Hu, Mu, Rt
Applications: WB, ICC
NBP2-27203
Species: Hu, Mu, Rt, Po, Ch, ChHa, Eq, Fe, GP, Op, Pm, Rb
Applications: WB, Flow
NBP1-47839
Species: Hu, Ca
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NBP1-91991
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-81706
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-50179
Species: Hu
Applications: WB, Flow, ICC/IF, IP, CyTOF-ready
NBP1-56729
Species: Hu
Applications: WB, IP

Publications for MLKL Antibody (NBP1-56729)(4)

Reviews for MLKL Antibody (NBP1-56729) (0)

There are no reviews for MLKL Antibody (NBP1-56729). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for MLKL Antibody (NBP1-56729) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Positive Control Lysate(s)

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for MLKL Antibody (NBP1-56729)

Discover related pathways, diseases and genes to MLKL Antibody (NBP1-56729). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MLKL Antibody (NBP1-56729)

Discover more about diseases related to MLKL Antibody (NBP1-56729).
 

Pathways for MLKL Antibody (NBP1-56729)

View related products by pathway.

PTMs for MLKL Antibody (NBP1-56729)

Learn more about PTMs related to MLKL Antibody (NBP1-56729).
 

Research Areas for MLKL Antibody (NBP1-56729)

Find related products by research area.

Blogs on MLKL.

Apoptosis and Necroptosis Part II: Inhibitors of apoptosis proteins (IAPs); Key regulators of the balance between necroptosis, apoptosis and survival
In the first installment of this two-part blog post titled "Apoptosis and Necroptosis: Important factors to identify both types of programmed cell death", the mechanisms by which cell death occurs and ways to identify these pathways were...  Read full blog post.

Apoptosis and Necroptosis Part I: Important factors to identify both types of programmed cell death
Different types of cell death have classically been identified by discrete morphological changes. The hallmarks of apoptosis include cell shrinkage, nuclear fragmentation and membrane blebbing whereas necroptosis is characterized by cell swelling...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our MLKL Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol MLKL
Entrez
Uniprot