Mitochondrial ribosomal protein L11 Antibody


Western Blot: Mitochondrial ribosomal protein L11 Antibody [NBP2-33844] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
Immunocytochemistry/ Immunofluorescence: Mitochondrial ribosomal protein L11 Antibody [NBP2-33844] - Staining of human cell line CACO-2 shows localization to mitochondria.
Immunohistochemistry-Paraffin: Mitochondrial ribosomal protein L11 Antibody [NBP2-33844] - Staining of human colon shows strong cytoplasmic positivity in glandular cells.

Product Details

Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P

Order Details

Mitochondrial ribosomal protein L11 Antibody Summary

This antibody was developed against a recombinant protein corresponding to amino acids: PTVSYFLKAAAGIEKGARQTGKEVAGLVTLKHVYEIARIKAQDEAFALQDVPLSSVVRSIIGSARSLGIR
Specificity of human Mitochondrial ribosomal protein L11 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (90%), Rat (91%). Backed by our 100% Guarantee.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.04-0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
Mitochondrial ribosomal protein L11 Protein (NBP2-33844PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for Mitochondrial ribosomal protein L11 Antibody

  • L11MT
  • MGC111024
  • mitochondrial ribosomal protein L11
  • MRP-L11,39S ribosomal protein L11, mitochondrial


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, I
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Rt
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF
Species: Hu
Applications: WB, ELISA, IHC, IHC-P, S-ELISA
Species: Hu
Applications: WB, IHC
Species: Hu
Applications: WB, IHC, IHC-P, IP
Species: Hu
Applications: WB, ICC
Species: Hu
Applications: Flow, IHC, CyTOF-ready
Species: Hu
Applications: WB, ELISA, ICC/IF, S-ELISA
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, RNAi, S-ELISA
Species: Hu
Applications: WB, IHC
Species: Hu
Applications: WB, IHC, IHC-P

Publications for Mitochondrial ribosomal protein L11 Antibody (NBP2-33844) (0)

There are no publications for Mitochondrial ribosomal protein L11 Antibody (NBP2-33844).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Mitochondrial ribosomal protein L11 Antibody (NBP2-33844) (0)

There are no reviews for Mitochondrial ribosomal protein L11 Antibody (NBP2-33844). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Mitochondrial ribosomal protein L11 Antibody (NBP2-33844) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Other Available Formats

Additional Mitochondrial ribosomal protein L11 Products

Bioinformatics Tool for Mitochondrial ribosomal protein L11 Antibody (NBP2-33844)

Discover related pathways, diseases and genes to Mitochondrial ribosomal protein L11 Antibody (NBP2-33844). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Mitochondrial ribosomal protein L11 Antibody (NBP2-33844)

Discover more about diseases related to Mitochondrial ribosomal protein L11 Antibody (NBP2-33844).

Pathways for Mitochondrial ribosomal protein L11 Antibody (NBP2-33844)

View related products by pathway.

PTMs for Mitochondrial ribosomal protein L11 Antibody (NBP2-33844)

Learn more about PTMs related to Mitochondrial ribosomal protein L11 Antibody (NBP2-33844).

Research Areas for Mitochondrial ribosomal protein L11 Antibody (NBP2-33844)

Find related products by research area.

Blogs on Mitochondrial ribosomal protein L11

There are no specific blogs for Mitochondrial ribosomal protein L11, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our Mitochondrial ribosomal protein L11 Antibody and receive a gift card or discount.


Gene Symbol MRPL11