We're moving to rndsystems.com. Come with us!

After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.

MiRP2 Recombinant Protein Antigen

Images

 
There are currently no images for MiRP2 Protein (NBP1-83238PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

MiRP2 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human KCNE3.

Source: E. coli

Amino Acid Sequence: METTNGTETWYESLHAVLKALNATLHSNLLCRPGPGLGPDNQTEERRASLPGRDDN

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
KCNE3
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-83238.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
24 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for MiRP2 Recombinant Protein Antigen

  • cardiac voltage-gated potassium channel accessory subunit
  • DKFZp781H21101
  • HOKPPMGC102685
  • HYPP
  • MGC129924
  • Minimum potassium ion channel-related peptide 2
  • MinK-related peptide 2
  • MiRP2
  • Potassium channel subunit beta MiRP2
  • potassium voltage-gated channel subfamily E member 3
  • potassium voltage-gated channel, Isk-related family, member 3
  • voltage-gated K+ channel subunit MIRP2

Background

Voltage-gated potassium (Kv) channels represent the most complex class of voltage-gated ion channels from both functional and structural standpoints. Their diverse functions include regulating neurotransmitter release, heart rate, insulin secretion, neuronal excitability, epithelial electrolyte transport, smooth muscle contraction, and cell volume. This gene encodes a member of the potassium channel, voltage-gated, isk-related subfamily. This member is a type I membrane protein, and a beta subunit that assembles with a potassium channel alpha-subunit to modulate the gating kinetics and enhance stability of the multimeric complex. This gene is prominently expressed in the kidney. A missense mutation in this gene is associated with hypokalemic periodic paralysis. (provided by RefSeq)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00003753-M01
Species: Ca, Gp, Hu, Pm, Rt
Applications: ELISA, ICC/IF, KD, WB
NBP2-12897
Species: Ha, Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, IP, MiAr, WB
NBP2-38146
Species: Hu
Applications: IHC,  IHC-P
NBP2-85189
Species: Hu
Applications: IHC,  IHC-P, WB
NBP1-22990
Species: Hu, Mu
Applications: IP, WB
NBP3-03109
Species: Hu, Mu
Applications: ELISA, IHC,  IHC-P, WB
NBP2-30861
Species: Hu
Applications: ICC/IF
NBP3-03750
Species: Hu, Mu, Rt
Applications: ELISA, IHC,  IHC-P, WB
NBP1-85835
Species: Hu
Applications: IHC,  IHC-P
NBP1-81049
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NB300-542
Species: Gp, Hu, Mu, Rb, Rt
Applications: Flow, IHC, IHC-Fr,  IHC-P, IP, WB
NBP1-84730
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
DNST0
Species: Hu
Applications: ELISA
NBP2-84125
Species: Hu
Applications: IHC,  IHC-P, WB
NBP2-38498
Species: Hu
Applications: IHC,  IHC-P
NB300-279
Species: Ha, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, WB
NBP2-12900
Species: Hu, Pm, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, MiAr, WB
NBP2-14142
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
NBP1-82861
Species: Hu
Applications: ICC/IF, IHC,  IHC-P

Publications for MiRP2 Protein (NBP1-83238PEP) (0)

There are no publications for MiRP2 Protein (NBP1-83238PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MiRP2 Protein (NBP1-83238PEP) (0)

There are no reviews for MiRP2 Protein (NBP1-83238PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for MiRP2 Protein (NBP1-83238PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional MiRP2 Products

Blogs on MiRP2

There are no specific blogs for MiRP2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our MiRP2 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol KCNE3