MIR16 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: MIR16 Antibody [NBP2-57760] - Staining of human cell line MCF7 shows localization to nucleoli & vesicles.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

MIR16 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: AKNGATGVELDIEFTSDGIPVLMHDNTVDRTTDGTGRLCDLTFEQIRKLNPAANHRLRNDFPDEKIPTLREAVAECLNHNLTIFFDVKGHAHKATEALKKMYMEFPQL
Specificity
Specificity of human MIR16 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
GDE1
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
MIR16 Recombinant Protein Antigen (NBP2-57760PEP)

Reactivity Notes

Mouse 86%, Rat 88%

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for MIR16 Antibody

  • EC 3.1.4.44
  • glycerophosphodiester phosphodiesterase 1
  • membrane interacting protein of RGS16
  • Membrane-interacting protein of RGS16
  • MIR16363E6.2
  • RGS16-interacting membrane protein

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-01584
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
H00151056-B01P
Species: Hu, Mu
Applications: WB
H00002166-M07
Species: Hu, Mu, Rt
Applications: WB, ELISA, S-ELISA
NBP1-83711
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-81858
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-24653
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-71691
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
640-A3
Species: Mu
NBP2-02105
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB110-80070
Species: Hu, Mu, Rt, Fu
Applications: WB, ICC/IF
NBP2-02541
Species: Hu, Pm
Applications: WB, ICC/IF, IHC, IHC-P
NB110-68136
Species: Hu, Mu, Rt, Fe
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready, Flow-IC
NBP1-88908
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-41268
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP3-05186
Species: Hu, Rt
Applications: WB, IHC
NBP1-59631
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-57760
Species: Hu
Applications: ICC/IF

Publications for MIR16 Antibody (NBP2-57760) (0)

There are no publications for MIR16 Antibody (NBP2-57760).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MIR16 Antibody (NBP2-57760) (0)

There are no reviews for MIR16 Antibody (NBP2-57760). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for MIR16 Antibody (NBP2-57760) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional MIR16 Products

Bioinformatics Tool for MIR16 Antibody (NBP2-57760)

Discover related pathways, diseases and genes to MIR16 Antibody (NBP2-57760). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MIR16 Antibody (NBP2-57760)

Discover more about diseases related to MIR16 Antibody (NBP2-57760).
 

Pathways for MIR16 Antibody (NBP2-57760)

View related products by pathway.

Blogs on MIR16

There are no specific blogs for MIR16, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our MIR16 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol GDE1